DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and ZNF14

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_066358.2 Gene:ZNF14 HGNCID:12924 Length:642 Species:Homo sapiens

Alignment Length:730 Identity:165/731 (23%)
Similarity:255/731 (35%) Gaps:196/731 (27%)


  Fly   270 NLDLTKLDQPGAS-YWCNICCRRLKSRLYYNQHLRSGYHIKRAEAECELEQATLGRELTLSKDFS 333
            |:::.|....||. :.|:.|.|........|:|:||  |..:...|.:..:....:...:.|.||
Human    89 NVNINKETFTGAKPHECSFCGRDFIHHSSLNRHMRS--HTGQKPNEYQEYEKQPCKCKAVGKTFS 151

  Fly   334 IKDDADKNE-----PKPPKRQRRANLLRCDLCRHTMARHLIGKHLISHYHFRRLQQQSRIRRQAC 393
            ......|:|     .||         ..|..|         ||..|.:..|:|.::         
Human   152 YHHCFRKHERTHTGVKP---------YECKQC---------GKAFIYYQPFQRHER--------- 189

  Fly   394 LQEILKHMGSIVRQSPFQCMPCRFYANTEETFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNN 458
                 .|.|    |.|::|..|      .:||:|:....:|....|:   .:.|..|      ..
Human   190 -----THAG----QKPYECKQC------GKTFIYYQSFQKHAHTGKK---PYECKQC------GK 230

  Fly   459 SMLLHLLDSSHKEVLLALNRSVPICIAQRRRIQCSRCGMEFLYNIQLRQHSITEHPGLALTGTAA 523
            :.:.:.....||.....           .:..:|.:||..|......|.|..| |.|        
Human   231 AFICYQSFQRHKRTHTG-----------EKPYECKQCGKAFSCPTYFRTHERT-HTG-------- 275

  Fly   524 DEYQSRFRCNLCGSSQKSRLALQRHKKHKHHLARYFCAICRLEFDNSLDARRHRSLVIHKQKARP 588
               :..::|..||.:.....:.:|||:.......|.|..|...|..|...|.|  ::|| ..|||
Human   276 ---EKPYKCKECGKAFSFLSSFRRHKRTHSGEKPYECKECGKAFFYSASFRAH--VIIH-TGARP 334

  Fly   589 QTSIPQPENEIEHMLREVLEETVPSPPAKRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSDNHL 653
            .                                   ||....|...||.....|:........:.
Human   335 Y-----------------------------------KCKECGKAFNSSNSCRVHERTHIGEKPYE 364

  Fly   654 CLSCGISFESAQALGRHTRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHT 718
            |..||.||..:.:|..|.|       |.|        .:..|.|.||.....:.|.|..|...||
Human   365 CKRCGKSFSWSISLRLHER-------THT--------GEKPYECKQCHKTFSFSSSLREHETTHT 414

  Fly   719 RSGTIGKNEVLQCPLCPKNFK-KHSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKV 782
                  ..:..:|..|.|.|. ..||:.|.|.|..||.:||.:|.:.|......:.|   :.:..
Human   415 ------GEKPYECKQCGKTFSFSSSLQRHERTHNAEKPYECKQCGKAFRCSSYFRIH---ERSHT 470

  Fly   783 GDKEKKKYAAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGRT-- 845
            |:|               .|:|..|||:..:..|.:|||.:|:.  |:.|     :|...|:|  
Human   471 GEK---------------PYECKQCGKVFIRSSSFRLHERTHTG--EKPY-----ECKLCGKTFS 513

  Fly   846 -PESLKTHLVSHS-QENHKCARINCSYVGKSELHLKRHLKSAHSTEKNGEEWFSCDQCDFRARIK 908
             ..||:.|...|: .:..:|.:...:::..|::.|       |.....||:.:.|.||.......
Human   514 FSSSLREHEKIHTGNKPFECKQCGKAFLRSSQIRL-------HERTHTGEKPYQCKQCGKAFISS 571

  Fly   909 GHLRRHSLRHSGQKPHQCPHCD----FQCSTIDNLRKHIIKTGKHPGMFIYHCAKCSDEEAGEIF 969
            ...|.|...|:|:||::|..|.    |..|...:.|.|   ||:.|    |.|.:|     |:.|
Human   572 SKFRMHERTHTGEKPYRCKQCGKAFRFSSSVRIHERSH---TGEKP----YECKQC-----GKAF 624

  Fly   970 KSNSYKEYQHHLKTH 984
            .|:|:  ::.|.:||
Human   625 ISSSH--FRLHERTH 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 6/20 (30%)
C2H2 Zn finger 731..750 CDD:275368 8/20 (40%)
C2H2 Zn finger 758..779 CDD:275368 4/21 (19%)
C2H2 Zn finger 804..824 CDD:275368 8/20 (40%)
C2H2 Zn finger 834..856 CDD:275368 6/25 (24%)
C2H2 Zn finger 898..918 CDD:275368 5/20 (25%)
zf-H2C2_2 910..935 CDD:290200 10/29 (34%)
C2H2 Zn finger 926..945 CDD:275368 6/23 (26%)
C2H2 Zn finger 957..984 CDD:275368 8/27 (30%)
ZNF14NP_066358.2 KRAB 4..>46 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 80..97 CDD:275368 2/8 (25%)
C2H2 Zn finger 105..125 CDD:275368 7/22 (32%)
C2H2 Zn finger 143..163 CDD:275368 5/20 (25%)
C2H2 Zn finger 171..191 CDD:275368 7/43 (16%)
C2H2 Zn finger 199..217 CDD:275368 6/24 (25%)
C2H2 Zn finger 225..245 CDD:275368 4/26 (15%)
zf-H2C2_2 237..262 CDD:290200 6/36 (17%)
COG5048 249..633 CDD:227381 120/501 (24%)
C2H2 Zn finger 253..273 CDD:275368 7/21 (33%)
zf-H2C2_2 265..289 CDD:290200 8/36 (22%)
C2H2 Zn finger 281..301 CDD:275368 6/20 (30%)
zf-H2C2_2 293..316 CDD:290200 6/23 (26%)
C2H2 Zn finger 309..329 CDD:275368 7/22 (32%)
C2H2 Zn finger 337..357 CDD:275368 5/20 (25%)
C2H2 Zn finger 365..385 CDD:275368 9/27 (33%)
zf-H2C2_2 377..401 CDD:290200 9/39 (23%)
C2H2 Zn finger 393..413 CDD:275368 6/20 (30%)
zf-H2C2_2 405..429 CDD:290200 8/30 (27%)
C2H2 Zn finger 421..441 CDD:275368 8/20 (40%)
C2H2 Zn finger 449..469 CDD:275368 4/23 (17%)
zf-H2C2_2 461..486 CDD:290200 8/43 (19%)
C2H2 Zn finger 477..497 CDD:275368 8/20 (40%)
C2H2 Zn finger 505..525 CDD:275368 6/20 (30%)
zf-H2C2_2 517..542 CDD:290200 5/25 (20%)
C2H2 Zn finger 533..553 CDD:275368 4/27 (15%)
C2H2 Zn finger 561..581 CDD:275368 5/20 (25%)
zf-H2C2_2 574..596 CDD:290200 8/22 (36%)
C2H2 Zn finger 589..609 CDD:275368 5/20 (25%)
zf-H2C2_2 601..626 CDD:290200 11/37 (30%)
C2H2 Zn finger 617..637 CDD:275368 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.