DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and znf142

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:XP_690036.3 Gene:znf142 ZFINID:ZDB-GENE-080512-2 Length:1535 Species:Danio rerio

Alignment Length:993 Identity:212/994 (21%)
Similarity:330/994 (33%) Gaps:284/994 (29%)


  Fly     7 EDTHLCIRCNATILGLSKYIDHRKRNCLITGKQNASPKTDGRTRISADTHVSATLISSSNLDHSY 71
            ::.:.|.||:......:..:.|.|.:|.:.       ||..|.:..                   
Zfish   736 DNMYQCSRCSYVTRKQAALVRHSKTSCQVM-------KTGLRCQDC------------------- 774

  Fly    72 DGFHFTEPEAPSSY-LRK-TAASHGGKTSKSLTEAYDLPYELGADLFFSSLQLQSVATGGKIGSV 134
             |.||.:..:..:: ||| .:...|||.|       |||..:|                      
Zfish   775 -GMHFKQQRSLHTHRLRKCRSLPSGGKKS-------DLPNAIG---------------------- 809

  Fly   135 PRQERSKDESWSAP--AGDPLLKAVRENDETVFKPLHFDHEYPEASDEEDDEDEHEEFDAEEDEE 197
             :.||....|.|..  :|.|.::.  |:.|.....|....| |:.|......|..:|.|:     
Zfish   810 -KSERCVGHSRSTNLISGTPTIQI--ESLEVTDLRLKGSAE-PQGSLSPIITDVIDETDS----- 865

  Fly   198 EYDARRHSPPIVPASHTGGKWKPEQRPQLRHPHIERLSPSWDEPPEENYTHPPADHTKGKWVPGS 262
                       :|::...|        |.....|.:|:                           
Zfish   866 -----------LPSTSEEG--------QATIRTINKLA--------------------------- 884

  Fly   263 KQLEYRENLDLTKLDQPGASYWCNICCRRLKSRLYYNQHLR----SGYHIKRAEAECELEQATLG 323
             :::...|.:::...:.|..:.|..|......::..|:|..    |...|..||...:.||    
Zfish   885 -KVDVSVNDEVSGYTEEGGRFTCRTCPFSSVRKVTINRHCATCSGSAPKIYLAEMAGQFEQ---- 944

  Fly   324 RELTLSKDFSIKDDADKN-------------EPKPPKRQRRANLLRCD-LCRHTMARHLIGKHLI 374
                 ...|:..|..|::             :.:.|....|.:...|. ||....|       |.
Zfish   945 -----EDHFNDSDQEDEDVDGANDSEGDSAVDERSPSSIPRFSCPNCPFLCHQKRA-------LA 997

  Fly   375 SHYHFRRLQQQSRIRRQACLQEILKHMGSIVRQSPFQCMPCRFYANTEETFLYHWKSH-EHLELT 438
            ||            ..:.||           :|...||..|.|.|.::::..:|..|| :..:.|
Zfish   998 SH------------EVKGCL-----------KQGEIQCPHCSFVAKSDKSLSHHILSHKKDKKAT 1039

  Fly   439 K-RLGGTFWCSFCQFNSNTNNSMLLHLLDSSHKEVLLALNRSVPICIAQRRRIQCSRCGMEFLYN 502
            | :..|...|..|.|.......::.|:. ..|:.|               |..||..|....:..
Zfish  1040 KGKRSGNLQCDLCSFTCKQERCLMQHVA-VKHEGV---------------RPHQCRFCSFSTVRR 1088

  Fly   503 IQLRQHSITEHPGLALTGTAADEYQSRFRCNLCGSS--QKSRLALQRHKKHKHHLARYFCAICRL 565
            .:|..|. :.|.|:           .|..|.|||.:  ..|||.|...:.|... |.:||::|..
Zfish  1089 YRLEAHE-SMHTGV-----------GRHSCELCGQTFGTTSRLRLHHQRIHDKQ-ATHFCSVCDY 1140

  Fly   566 EFDNSLDARRHRSLVIHKQKARPQTSIPQPENEIEHMLREVLEETVPSPPAKRSADVNAKCSNSR 630
            ...|..|..|| :|..|                                    :.::...||...
Zfish  1141 RAYNLNDINRH-NLSCH------------------------------------TGELRYHCSQCD 1168

  Fly   631 KTIESSQRLAQHQAEVHSSDNHL-CLSCGISFESAQALGRHTRSCQPLASTSTPADLSQAQ-KKS 693
            ....|...|.||...|||..|.| |..|..:.....||..|.:| .....|:.|.|..:.: |||
Zfish  1169 ARFSSDGALKQHCHRVHSDANTLPCTQCSFTCRGQAALKAHMQS-DHSEKTNDPQDNPEKRSKKS 1232

  Fly   694 M-YSCDQCRFQSQYESDLVYHRIFHTRSGTIGKNEVLQCPLCPKNFK-KHSL--RAHLRNHTNEK 754
            : :.|..|.|.:.....||.|.:.....|. .:.:.|:|.:|  .|. .|.:  ..|:|:|....
Zfish  1233 ITHKCTVCSFNTNKRLLLVQHMLDEHEDGP-AEEKTLKCDVC--GFSCTHQMVFDQHIRSHGGTC 1294

  Fly   755 IFECTECLQKFARRHNLKNHVITKHAKV--GDK----EKKKYAAKD---------VEQSKPKYQC 804
            :|:||||  :|:.|:..|   ||.|.::  |:|    ||..||..|         :...:.||.|
Zfish  1295 LFKCTEC--EFSTRNKQK---ITWHIRIHTGEKPYRCEKCNYACADPSRLKYHMRIHMDERKYLC 1354

  Fly   805 GTCGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPESLKTHLVSHSQENHKCARINCS 869
            ..||........||.|...|:.|  :.|.|.  ||.|.....::|:.|..:..::........|.
Zfish  1355 PECGYKCKWVNQLKYHMTKHTGA--KPYACE--DCEYRTNRADALRIHRETRHRDVRSFICEKCG 1415

  Fly   870 YVGKSELHLKRHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSGQKPHQCPHCDFQCS 934
            ...|:...||.|.:. ||..:.    :.|..|....|....||.|.|.|:.|.|..|.||.::..
Zfish  1416 KAFKTRFLLKTHQRK-HSEARP----YVCSVCQKAFRWPAGLRHHYLSHTNQLPFYCLHCPYRAK 1475

  Fly   935 TIDNLRKHIIKTGKHPGM 952
            ....:.||:.:  .||.:
Zfish  1476 QKFQVVKHLHR--HHPDL 1491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 6/20 (30%)
C2H2 Zn finger 731..750 CDD:275368 6/22 (27%)
C2H2 Zn finger 758..779 CDD:275368 9/21 (43%)
C2H2 Zn finger 804..824 CDD:275368 6/20 (30%)
C2H2 Zn finger 834..856 CDD:275368 6/22 (27%)
C2H2 Zn finger 898..918 CDD:275368 7/20 (35%)
zf-H2C2_2 910..935 CDD:290200 10/25 (40%)
C2H2 Zn finger 926..945 CDD:275368 5/19 (26%)
C2H2 Zn finger 957..984 CDD:275368
znf142XP_690036.3 COG5048 80..503 CDD:227381
C2H2 Zn finger 86..106 CDD:275368
C2H2 Zn finger 114..134 CDD:275368
C2H2 Zn finger 178..198 CDD:275368
C2H2 Zn finger 242..261 CDD:275368
C2H2 Zn finger 266..316 CDD:275368
C2H2 Zn finger 324..344 CDD:275368
C2H2 Zn finger 352..372 CDD:275368
C2H2 Zn finger 380..400 CDD:275368
C2H2 Zn finger 408..428 CDD:275368
C2H2 Zn finger 435..452 CDD:275368
C2H2 Zn finger 1078..1098 CDD:275370 4/21 (19%)
C2H2 Zn finger 1106..1127 CDD:275368 8/21 (38%)
C2H2 Zn finger 1135..1156 CDD:275368 7/22 (32%)
C2H2 Zn finger 1164..1185 CDD:275368 7/21 (33%)
C2H2 Zn finger 1193..1210 CDD:275368 5/17 (29%)
C2H2 Zn finger 1270..1290 CDD:275368 6/22 (27%)
C2H2 Zn finger 1298..1318 CDD:275368 10/25 (40%)
C2H2 Zn finger 1326..1346 CDD:275368 5/20 (25%)
C2H2 Zn finger 1354..1374 CDD:275368 6/20 (30%)
C2H2 Zn finger 1382..1403 CDD:275368 6/23 (26%)
C2H2 Zn finger 1411..1431 CDD:275368 5/21 (24%)
C2H2 Zn finger 1439..1459 CDD:275368 7/20 (35%)
C2H2 Zn finger 1467..1487 CDD:275368 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.