DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and ZNF280C

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_060136.1 Gene:ZNF280C HGNCID:25955 Length:737 Species:Homo sapiens

Alignment Length:939 Identity:172/940 (18%)
Similarity:264/940 (28%) Gaps:374/940 (40%)


  Fly   160 NDETVFKPLHFD---HEYPEASDEEDD--EDEHEEFDAEEDEE-----EYDA----------RRH 204
            :|:..|:|.:..   ..:.|..:||.:  :.:.||...|:|:|     |..:          |.|
Human     2 DDDKPFQPKNISKMAELFMECEEEELEPWQKKVEETQDEDDDELIFVGEISSSKPAISNILNRGH 66

  Fly   205 SPPIVPASHTGGKWKPEQRPQLRHPHIER-LSPSWDEPPEENYTHPPADHTKGKWVPGSKQLEYR 268
            |    .:|..|.|.:|.. |.:  |.|.| .|....:||.......|..|...|....|..:|..
Human    67 S----SSSSKGIKSEPHS-PGI--PEIFRTASQRCRDPPSNPVAASPRFHLVSKSSQSSVTVENA 124

  Fly   269 ENLDLTKLDQPGASYWCNICCRRLKSRL--------YYNQHLRSGYHIKRAEAECELEQATLGRE 325
            ...|.||..|.|:.....:.....:..|        .:.:.:::..::.:..:..::...|..:.
Human   125 SKPDFTKNSQVGSDNSSILLFDSTQESLPPSQDIPAIFREGMKNTSYVLKHPSTSKVNSVTPKKP 189

  Fly   326 LTLSKDFSIKDDADKNEP--------KPPKRQRR----------------ANLLR-CDLCRHTMA 365
            .|       .:|..:..|        .||....:                |:.|| |..|     
Human   190 KT-------SEDVPQINPSTSLPLIGSPPVTSSQVMLSKGTNTSSPYDAGADYLRACPKC----- 242

  Fly   366 RHLIGKHLISHYHFRRLQQQSRIRRQACLQEILKHMGSIVRQSPFQCMPCRFYANTEETFLYHWK 430
                      :..|..|.......:..|...|.|.:|.||:..    .||    :.::|      
Human   243 ----------NVQFNLLDPLKYHMKHCCPDMITKFLGVIVKSE----RPC----DEDKT------ 283

  Fly   431 SHEHLELTKRLGGTFWCSFCQFNSNTNNSMLLHLLDSSHKEVLLALNRSVPICIAQRRRIQCSRC 495
                                               ||...::::.:|                  
Human   284 -----------------------------------DSETGKLIMLVN------------------ 295

  Fly   496 GMEFLYNIQLRQHSITEHPGLALTGTAADEYQSRFRCNLCGSSQKSRLALQRHKKHKHHLARYFC 560
              ||.|.   |...:||......|         .|:|..|....|:.:....|.  ||||     
Human   296 --EFYYG---RHEGVTEKEPKTYT---------TFKCFSCSKVLKNNIRFMNHM--KHHL----- 339

  Fly   561 AICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPENEIEHMLREVLEETVPSPPAKRSADVNAK 625
               .||..|:.....|.:                    .:|..|:     .|:|           
Human   340 ---ELEKQNNESWENHTT--------------------CQHCYRQ-----YPTP----------- 365

  Fly   626 CSNSRKTIESSQRLAQHQAEVHSSDNH-------LCLSCGISFESAQALGRHTRSCQPLASTSTP 683
                            .|.:.|....|       :|..|.:|||:...|.:|      :..|..|
Human   366 ----------------FQLQCHIESTHTPHEFSTICKICELSFETEHILLQH------MKDTHKP 408

  Fly   684 ADLSQAQKKSMYSCDQCRFQSQYESDLVYH-RIFHTRSGTIGKNEVLQCPLCPKNFKKHS-LRAH 746
            .::.       |.|..|:|:|...||:..| |..|..:    ||  |.||.|.|..|..: ...|
Human   409 GEMP-------YVCQVCQFRSSTFSDVEAHFRAAHENT----KN--LLCPFCLKVSKMATPYMNH 460

  Fly   747 LRNHTNEKIFECTECLQKFARRHNLKNH--------------------VITKHAKVG-------- 783
            ...|..:.:..|.:|..:|........|                    .:|..|.:|        
Human   461 YMKHQKKGVHRCPKCRLQFLTSKEKAEHKAQHRTFIKPKELEGLPPGAKVTIRASLGPLQSKLPT 525

  Fly   784 ----------------------------------DKEKKKYA----AKDVEQSKPKYQCGTCGKL 810
                                              .|..|.:|    |..|..|||:   |...|.
Human   526 APFGCAPGTSFLQVTPPTSQNTTARNPRKSNASRSKTSKLHATTSTASKVNTSKPR---GRIAKS 587

  Fly   811 LAK-------------KYSLKLHEISHSKAVERNYLCH-----FAD----------CSYAGRTPE 847
            .||             |.||.|..|...:.:.:...||     ||.          |.|.....:
Human   588 KAKPSYKQKRQRNRKNKMSLALKNIRCRRGIHKCIECHSKIKDFASHFSIYIHCSFCKYNTNCNK 652

  Fly   848 SLKTHLVSHSQENHKCARINCSYVGKSELHLKRHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLR 912
            :...|::| |..||.         ||.....|:|..:.....      ..|.:|||.|...| |.
Human   653 AFVNHMMS-SHSNHP---------GKRFCIFKKHSGTLRGIT------LVCLKCDFLADSSG-LD 700

  Fly   913 RHSLRHSGQKPHQCPHCDFQCSTIDNLRK 941
            |.:...|.:|.|.|.      ..|:|:.|
Human   701 RMAKHLSQRKTHTCQ------VIIENVSK 723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 8/21 (38%)
C2H2 Zn finger 731..750 CDD:275368 6/20 (30%)
C2H2 Zn finger 758..779 CDD:275368 5/41 (12%)
C2H2 Zn finger 804..824 CDD:275368 9/33 (27%)
C2H2 Zn finger 834..856 CDD:275368 8/37 (22%)
C2H2 Zn finger 898..918 CDD:275368 8/20 (40%)
zf-H2C2_2 910..935 CDD:290200 6/25 (24%)
C2H2 Zn finger 926..945 CDD:275368 4/17 (24%)
C2H2 Zn finger 957..984 CDD:275368
ZNF280CNP_060136.1 DUF4195 46..227 CDD:316361 32/195 (16%)
C2H2 Zn finger 355..376 CDD:275368 6/53 (11%)
C2H2 Zn finger 385..406 CDD:275368 8/27 (30%)
C2H2 Zn finger 415..433 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.