DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and CG4730

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_001262965.1 Gene:CG4730 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster

Alignment Length:446 Identity:90/447 (20%)
Similarity:145/447 (32%) Gaps:162/447 (36%)


  Fly   629 SRKTIESSQRLAQHQAEVHSSDNHL-----CLSC------------GISFESAQALGRHTRSCQP 676
            :|:|.|:..:|..|:..:..|...|     |..|            .:.::...||..:  .|..
  Fly    17 ARRTAEAPVKLVSHEVSLSDSTTSLELSNCCRLCLEEPYPNQMLDMTVIYDQEAALSYY--DCYE 79

  Fly   677 LASTSTPADLSQAQKKSMYS-CDQCRFQSQYESDLVYHR-----------IF-HTRSGTIGKNEV 728
            :.   |..||.|..|....: |.:|..:.::..|  :|:           || .|.:.|..:::|
  Fly    80 IC---TKEDLRQNPKNEPRTLCKRCAVELKWAYD--FHKKMAIANQQLREIFVATEANTEQEDDV 139

  Fly   729 -----------------------------------------LQCPLCPKNFKKHSLRA-----HL 747
                                                     ..|..|.|.|:.||..|     ||
  Fly   140 EDEENEADMNEEFLMEEIEEKQETPIDSLEDIVPRNRHTGKSNCKFCHKEFRNHSRMAKHQMIHL 204

  Fly   748 RNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQSKPKYQCGTCGKLLA 812
            .|..|   |.|::|.:.:..:..||.||.:||.:.|                  ..|.||||:.|
  Fly   205 ANRPN---FRCSQCDRVYLTKQALKVHVDSKHRQSG------------------VHCDTCGKVFA 248

  Fly   813 KKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPESLKTHLVSHSQENHKCARINCSYVGKSELH 877
            ...:|::|:..|::  :..|.|...|..:|.|      :||..|.|..|..:|..|.:.|     
  Fly   249 IAKALEIHKRYHNR--DFPYSCDLCDRRFAQR------SHLTVHQQVKHSGSRFICEFPG----- 300

  Fly   878 LKRHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSGQKPHQCPHCDFQCSTIDNLRKH 942
                                   |.........||.|...|:.. |.:|.||.......:.||.|
  Fly   301 -----------------------CQKSFTSSSSLRNHECTHTAM-PFECAHCHQSYPARNKLRMH 341

  Fly   943 IIKTGKHPGMFI----------YHCAKCSDEEAGEIFKSNSYKEYQ--HHLKTHKA 986
            :.:  || .|.:          :|..:      .::..:..|.:.:  ||.|...|
  Fly   342 LER--KH-NMVVQMEDLEEMRKFHIVR------SKLVMAKIYSDQKESHHAKNDSA 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 6/32 (19%)
C2H2 Zn finger 731..750 CDD:275368 10/24 (42%)
C2H2 Zn finger 758..779 CDD:275368 7/21 (33%)
C2H2 Zn finger 804..824 CDD:275368 8/20 (40%)
C2H2 Zn finger 834..856 CDD:275368 6/22 (27%)
C2H2 Zn finger 898..918 CDD:275368 4/20 (20%)
zf-H2C2_2 910..935 CDD:290200 8/25 (32%)
C2H2 Zn finger 926..945 CDD:275368 6/19 (32%)
C2H2 Zn finger 957..984 CDD:275368 4/29 (14%)
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 14/85 (16%)
C2H2 Zn finger 183..203 CDD:275368 7/20 (35%)
C2H2 Zn finger 212..232 CDD:275368 6/20 (30%)
C2H2 Zn finger 240..260 CDD:275368 8/20 (40%)
C2H2 Zn finger 268..289 CDD:275368 8/27 (30%)
C2H2 Zn finger 296..318 CDD:275368 6/50 (12%)
C2H2 Zn finger 325..346 CDD:275368 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.