DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and CG17803

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster

Alignment Length:517 Identity:108/518 (21%)
Similarity:181/518 (35%) Gaps:141/518 (27%)


  Fly   491 QCSRC--------GMEFLY---NIQLRQHSITEHPGLALTGTAADEYQSRFRCNLCGSSQKS--- 541
            :|..|        ..:.||   ||.|..|.      ..:||....:.......::|.:.|::   
  Fly    85 KCRTCFRIISRHEDAQDLYDRVNIALLHHI------KVITGVWIQQGVKELPHHICSTCQETVNK 143

  Fly   542 ----RLALQR-HKKHKHHLARYFCAICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPENEIEH 601
                |...|: .||.:....:|...||..|.::.|:.      |::::.|:....:...|:....
  Fly   144 SMEFRAKCQQVDKKLRQTTEKYNIQICDEEMESELEN------VLYEESAQQAKGVVGLEDFSSE 202

  Fly   602 MLRE---VLEE---TVPSPPAKRS-----------------ADVNAKCSN--SRKTIESSQRLAQ 641
            :|.:   ||:|   .:.:.|.:.|                 .:.|..|:.  |.:..::.:.:.:
  Fly   203 LLPDSEGVLDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFALEQNKSCNEIISIRKCKTKEEIGK 267

  Fly   642 --HQAEVHSSDNHLCLSCGISFESAQALGRHT--RSCQPLASTSTPAD--------------LSQ 688
              |.|:|:.                ..||.:.  :...|..|.|.|..              ..:
  Fly   268 VDHGAKVYK----------------VVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRER 316

  Fly   689 AQKKSM-YSCDQCRFQSQYESDLVYHRIFHTRSGTIGKNEVLQCPLCPKNF-KKHSLRAHLRN-H 750
            .|.|.: |.||:|....:..|.|..|.:.|.|:    ||  .:||.|||.| ..::...|:|. |
  Fly   317 IQAKPLNYVCDKCGHTFRQRSQLQMHLLRHNRA----KN--FECPECPKKFYDLYTRNIHVRALH 375

  Fly   751 TNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQSKPKYQCGTCGKLLAKKY 815
            ..|..|.|..|.:.||...:...|....|. .|::.:.:..:|  |:...::.|..|.|....|.
  Fly   376 KGEHPFPCNHCNESFANASSRHRHERDVHG-AGNRIRTRVKSK--EEGSSRHYCTQCTKSYTSKK 437

  Fly   816 SLKLHEISHSKAVERNYLCHFADCSYAGRTPESLKTHLVSHSQENHKCARINCSYVGKSELHLKR 880
            .|.||...|:.:  |.:.|......:|  .|.::|.|                     ..||.|.
  Fly   438 GLVLHMNFHNGS--RPFQCKICQMKFA--DPSAMKRH---------------------QALHDKF 477

  Fly   881 HLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSGQKPHQCPHCDFQCSTIDNLRKH 942
            .::              ||.|.....::..|.:|...|:|..||:|..||.......||.||
  Fly   478 PIR--------------CDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKH 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 6/20 (30%)
C2H2 Zn finger 731..750 CDD:275368 8/21 (38%)
C2H2 Zn finger 758..779 CDD:275368 5/21 (24%)
C2H2 Zn finger 804..824 CDD:275368 7/20 (35%)
C2H2 Zn finger 834..856 CDD:275368 5/22 (23%)
C2H2 Zn finger 898..918 CDD:275368 5/20 (25%)
zf-H2C2_2 910..935 CDD:290200 9/25 (36%)
C2H2 Zn finger 926..945 CDD:275368 7/18 (39%)
C2H2 Zn finger 957..984 CDD:275368
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 16/80 (20%)
COG5048 <323..528 CDD:227381 64/252 (25%)
zf-C2H2 324..346 CDD:278523 7/22 (32%)
C2H2 Zn finger 326..346 CDD:275368 6/20 (30%)
C2H2 Zn finger 354..375 CDD:275368 8/21 (38%)
C2H2 Zn finger 383..401 CDD:275368 5/18 (28%)
C2H2 Zn finger 426..446 CDD:275368 7/20 (35%)
C2H2 Zn finger 454..474 CDD:275368 6/43 (14%)
C2H2 Zn finger 481..501 CDD:275368 5/20 (25%)
C2H2 Zn finger 509..528 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.