DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and CG7987

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_650375.1 Gene:CG7987 FlyBaseID:FBgn0038244 Length:1283 Species:Drosophila melanogaster

Alignment Length:836 Identity:167/837 (20%)
Similarity:262/837 (31%) Gaps:257/837 (31%)


  Fly   232 ERLSPSWDEPPEENYTHPPADHTKGKWVPGSKQLEYRENLDLTKLDQPGASYWCNICCRRLKSRL 296
            |.::..|.:..........|:...|  :..|::|...|..:.|.| :|   |.|:.|.||.:.:.
  Fly    95 EVITDDWVQHQGAERVEIAAEQIAG--ISSSQELLDMEQDEYTAL-RP---YPCDFCSRRFRKKA 153

  Fly   297 YYNQHLRSGYHIKRAEAECELEQATLGRELTLSKDF----SIKDDADKNEPKPPKRQRRANLLRC 357
            ..|.|:.:  |.......|:|..|...|...|...|    ..:|.||          ..|.....
  Fly   154 TLNNHMLA--HQNDRPHLCKLCGARFSRRAELISHFKAHAEAQDAAD----------AEAAAAAA 206

  Fly   358 DLCRHTMARHLIGKHLISHYH------FRRLQQQSRIRRQACLQEILKHMGSI---------VRQ 407
            |........|...:.|..||:      |:..|:|...::....|..:...|.|         |.|
  Fly   207 DSSSAIKFEHQTQRQLDDHYYEQEWPLFQHQQEQENAQQNVHQQHQIVEEGGIQLVASYPDTVAQ 271

  Fly   408 ----------------------------------------------------------------- 407
                                                                             
  Fly   272 PAAPSRGRISRLKPKEESSQFIVISDKSVEDSRPYMEPEPAQPVVTTSEFIAVEPPPQPNFPVLD 336

  Fly   408 --SPFQCMPCRFYANTEETFLYHWKSHEHLELTKRLGGTFWCSFCQ----FNSNTNNSMLLHLLD 466
              .||.|..|......|:..:.|.|:|       |:...|.|:.||    .||:.......|..:
  Fly   337 HSKPFVCQQCGLAFAREKALVSHTKNH-------RVDSPFECNQCQEMFWDNSSLQEHQKTHQFE 394

  Fly   467 SSHKEV-LLALNRSVPICIAQRR---RIQCSRCGMEFLYNIQLRQHS--ITEHPGLALTGTAAD- 524
            .|:.|. ..:...|.....|..:   ...|:.||:.|.....||:|:  ..:....|..|:.:| 
  Fly   395 ESNSEYDPASAEESGSESEADEQLYGEFYCNECGISFHRQDLLRRHAKMHCKPSDQAAVGSNSDV 459

  Fly   525 ---------EYQSRFRCNLCGSSQKSRLALQRHKKHKHHLARYFCAICRLEFDNSLDARRHRSLV 580
                     :..|...||.||.|..|.|.:..|.:.......:.|.:|.:.|......:||    
  Fly   460 TAGGDVELAKDSSGHCCNTCGKSFPSALEMLAHAEIHARFPPFKCVLCGISFYEEQAIKRH---- 520

  Fly   581 IHKQKARPQTSIPQPENEIEHMLREVLEETVPSPPAKRSADVNA-KCSNSRKTIESSQRLAQHQA 644
            :|                                 .:..:::|| .|....|.....:.|.:| |
  Fly   521 LH---------------------------------TRHPSELNANSCVLCGKECRDRKALIKH-A 551

  Fly   645 EVHSSDN-HLCLSCGISFESAQALGRHTRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYES 708
            ..||.:. |.|..||.:|.:...|.||               ::..:.||:. |:.|:.:.....
  Fly   552 WDHSREKCHSCSKCGKNFHNKARLKRH---------------MASHRDKSVV-CEVCQEEFPDGR 600

  Fly   709 DLVYHRIFHTRSGTIGKNEVLQCPLCPKNF-KKHSLRAHLRNHTNEKIFECTECLQKFARRHNLK 772
            .|..||..|:.: |.||  :..|..|.|.| .:.|.:.|:|.||.|:.:.|..|.:.||....|:
  Fly   601 TLSNHRHSHSTT-TPGK--LFPCLECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFADGGTLR 662

  Fly   773 NHVITKHAKVGDKEKKKYAAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKA--VERNYLCH 835
                 ||.::...||             .|.|..|.:...::..|:.|..||...  |.|| ..|
  Fly   663 -----KHERIHTGEK-------------PYACSVCPRAFNQRVVLREHIRSHHSGLDVARN-TYH 708

  Fly   836 FADCSYAGRTPESLKTHLVSHSQEN-------------HKCARINCSYVGKSELHLKRHLKSAHS 887
            ...||....:...|..||:.||..|             :|..|       |.:.|...|:::|:.
  Fly   709 CTVCSEDLASSNDLIQHLIQHSDSNTAKQRQPVTGPRKYKRRR-------KLQPHEIAHMRAANK 766

  Fly   888 TEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSGQKPHQC----PHCDFQCSTIDNL 939
             ..||:|..:..:.|                    ..:|    ..|||....:|::
  Fly   767 -HVNGDEEEAIGEGD--------------------AEECASDIDFCDFDVENVDDI 801

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 5/20 (25%)
C2H2 Zn finger 731..750 CDD:275368 7/20 (35%)
C2H2 Zn finger 758..779 CDD:275368 6/21 (29%)
C2H2 Zn finger 804..824 CDD:275368 5/20 (25%)
C2H2 Zn finger 834..856 CDD:275368 6/22 (27%)
C2H2 Zn finger 898..918 CDD:275368 1/20 (5%)
zf-H2C2_2 910..935 CDD:290200 4/29 (14%)
C2H2 Zn finger 926..945 CDD:275368 5/19 (26%)
C2H2 Zn finger 957..984 CDD:275368
CG7987NP_650375.1 C2H2 Zn finger 142..162 CDD:275368 6/22 (27%)
C2H2 Zn finger 170..186 CDD:275368 5/16 (31%)
COG5048 326..734 CDD:227381 111/491 (23%)
C2H2 Zn finger 343..363 CDD:275368 5/20 (25%)
C2H2 Zn finger 371..391 CDD:275368 5/20 (25%)
C2H2 Zn finger 424..444 CDD:275368 7/20 (35%)
C2H2 Zn finger 476..496 CDD:275368 8/20 (40%)
C2H2 Zn finger 504..523 CDD:275368 6/56 (11%)
C2H2 Zn finger 534..554 CDD:275370 5/21 (24%)
C2H2 Zn finger 562..582 CDD:275370 7/35 (20%)
C2H2 Zn finger 589..609 CDD:275368 5/20 (25%)
C2H2 Zn finger 620..640 CDD:275368 7/20 (35%)
C2H2 Zn finger 648..668 CDD:275368 7/25 (28%)
zf-H2C2_2 661..685 CDD:290200 8/42 (19%)
C2H2 Zn finger 676..696 CDD:275368 5/20 (25%)
C2H2 Zn finger 709..726 CDD:275371 4/17 (24%)
Hph 921..>1017 CDD:290417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.