DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and CG2199

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_728599.1 Gene:CG2199 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster

Alignment Length:517 Identity:96/518 (19%)
Similarity:169/518 (33%) Gaps:184/518 (36%)


  Fly   527 QSRFRCNLCGSSQKSR-----------------LALQRHKKHKHHLARYFCAICRLEFDNSLDAR 574
            |...||:.||:||.|:                 |....|:.....|....|.:|...|.:|    
  Fly    14 QKEVRCDHCGTSQGSKSVFSGQKVFLGRKITDVLETITHRSIPSSLPIKICFVCTSTFMSS---- 74

  Fly   575 RHRSLVIHKQKARPQTSIPQPENEIEHMLREVLEETVPSPPAKRSADVNAKCSNSRKTIESSQRL 639
               :.:|.|                   :||.::. |...|||::.....:..:::::.:.:.::
  Fly    75 ---AALIEK-------------------VRETVDR-VQEQPAKKTKVAEIEEPSTQESDKKAVKV 116

  Fly   640 AQHQAEVHSSDNHLCLSCGISFESAQALGRHTRSCQPLASTS----------------------- 681
            .:....:......:.     :|..:...|.:|.:...:.|.|                       
  Fly   117 PKKNTTLRQRSKSIA-----AFPPSFVNGANTNTEIEIISASPKKLDKTPKKQISRLFEDNLNDS 176

  Fly   682 ---TPADLSQAQKKSMYS--------CDQCRFQSQYESDLVYHRIFHTRSG--TIGKNEVLQCPL 733
               |||....:.||:..:        ..:...:|:.|.|        :..|  ||..|. .|||.
  Fly   177 VKLTPAKEVSSTKKAFLNLFGNGGNDAIEVLTESEEEED--------SDKGPITINTNN-FQCPE 232

  Fly   734 C------PKNFKKHSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKH-------AKVGDK 785
            |      ||.:|:|..:.|  .....:|:.||.|::.|.....||||:...|       ||...|
  Fly   233 CEFHAKFPKPYKEHLQKEH--GLQRPRIYPCTLCIKTFGVLKTLKNHLRDTHSRTFESEAKTKAK 295

  Fly   786 EKKKYAAKD----------------VEQSKPKYQCGTCGKLLAKKYSLKLH-------------- 820
            |.|:..||.                .::.|||.:     |...||..:|.:              
  Fly   296 ESKEKEAKSGAKNKIDAKAKETNAVSQRKKPKEK-----KSKEKKTEIKCNVETKVVDEIDDQVN 355

  Fly   821 ----------------EISHSKA-----VERNYLCHFADCSY-------AGRTPESLKTHLVSHS 857
                            :|:..||     :::..|.:..|..|       :..||.:        .
  Fly   356 NKKGTDSEDADQTQATKIASFKALNESLMKKRMLENVIDSEYTFAINGSSASTPRA--------D 412

  Fly   858 QENHKCARINCSYVGKSELHLKRHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHS 919
            ..|.:|...:|..:...:  ::.|:|:.||.:|  .:.|.|..|:.....|..|:.|...|:
  Fly   413 SNNFQCEICDCELMTAKQ--MQEHMKTVHSIDK--PKVFKCHVCEKSLATKQSLKTHMTLHA 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 3/20 (15%)
C2H2 Zn finger 731..750 CDD:275368 8/25 (32%)
C2H2 Zn finger 758..779 CDD:275368 8/21 (38%)
C2H2 Zn finger 804..824 CDD:275368 5/50 (10%)
C2H2 Zn finger 834..856 CDD:275368 4/29 (14%)
C2H2 Zn finger 898..918 CDD:275368 5/20 (25%)
zf-H2C2_2 910..935 CDD:290200 3/11 (27%)
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 4/23 (17%)
C2H2 Zn finger 449..469 CDD:275370 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.