DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and CG12744

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_610530.1 Gene:CG12744 FlyBaseID:FBgn0033459 Length:160 Species:Drosophila melanogaster

Alignment Length:160 Identity:39/161 (24%)
Similarity:62/161 (39%) Gaps:49/161 (30%)


  Fly   644 AEVHSSDNHLCLSCGISFESAQALGRH--TRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQY 706
            |||..|    ||.|..:|::.:.|..|  |...||:::..|              ||.|  ....
  Fly     6 AEVQLS----CLLCEQTFDATEKLDEHLPTHFPQPVSTGQT--------------CDIC--GRTM 50

  Fly   707 ESDLVYHRIFHTRSGTIGKNEVLQCPLCPKNFKKHSLRAHLRNHTNEKIFECTECLQKFARRHNL 771
            .|.|..|                      :::|::. .||:.|  .|..|:|..|.:.|..:.:|
  Fly    51 RSSLELH----------------------QHYKRYH-EAHVPN--TEGHFQCQLCDKVFLLQDHL 90

  Fly   772 KNHVITKHAKVGDKEKKKYAAKDVEQSKPK 801
            |.||..:||..|.:..:|  :.|.:...|:
  Fly    91 KVHVKIEHATDGYQPDEK--SLDWQHYSPR 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 6/20 (30%)
C2H2 Zn finger 731..750 CDD:275368 4/19 (21%)
C2H2 Zn finger 758..779 CDD:275368 7/21 (33%)
C2H2 Zn finger 804..824 CDD:275368
C2H2 Zn finger 834..856 CDD:275368
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
CG12744NP_610530.1 C2H2 Zn finger 12..32 CDD:275368 7/20 (35%)
C2H2 Zn finger 43..64 CDD:275368 7/45 (16%)
C2H2 Zn finger 77..96 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.