DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and CG43347

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_001138185.2 Gene:CG43347 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster

Alignment Length:1104 Identity:198/1105 (18%)
Similarity:336/1105 (30%) Gaps:386/1105 (35%)


  Fly    37 GKQNASPKTDGRTRISADTHVSATLISSSNLDHSYDGFHFTEPEA----------PSSYLRKTAA 91
            |..:...|:.|..:..|....:|.::..::.|.     |..||.|          ....|.:.|.
  Fly   849 GNFHVRSKSQGSKKSQAAKAAAAAMMPPNSYDE-----HDDEPGAGLGGNDEDDDDDEELDEEAL 908

  Fly    92 SHGGKTSKSLTEAYDLPYELGADLFFSSLQL---QSVATGGKIGSVPRQERSKDESWSAPAGDPL 153
            :...|..::..|..|     ..|:.|.|.|.   .|:|...|:  .|.:....:.:.:...|:.:
  Fly   909 AREMKMEQNFVEEED-----EHDIAFRSHQSCRECSIAHDHKL--CPLRNACGNVTDAVDLGEWI 966

  Fly   154 LKAVRENDETVFKPLHFD--HEYPEAS----DEEDDEDEHEEFDAEEDEEEYDARRHSPPI---- 208
               .|.|.|.:.| |..|  .:...||    .|:||.::.|:.|.:.||....:...:.|:    
  Fly   967 ---ERRNLEALAK-LKADAQRQAKRASGRQRHEDDDMEDMEDMDMDMDESSQLSELETKPLITFA 1027

  Fly   209 ---VPASHTGGKWKPE-----QRPQLRHPHIERLSPSWDEPPEENYTHPPADHTKGKWVPGSKQL 265
               |||.......:|.     .|.::|  ...:|.|...:|.:.......:|.   ||:     .
  Fly  1028 EASVPAEFELHNVEPNVTGVFARTEVR--AFTKLGPLIGQPVQTGEVREGSDM---KWI-----F 1082

  Fly   266 EYRE-NLDLTKL---DQPGASYWCN------------------------ICCRRLKS---RLYYN 299
            |..| ..|.:.|   |.|.||.|..                        :.||.|::   .||::
  Fly  1083 EMCEAGADKSYLLCCDNPNASNWLRFVRPAPSYEERNVNLVSIDRQAYFVSCRDLRNGMELLYWS 1147

  Fly   300 QHLRSGYHIKRAE----AECELEQATLGRELTLSKDFSIKDDADKNEPKPPKRQRRANLLRCDLC 360
            ....:.:..|..|    ..|.|:   ....|......|:..|        |..........|.:|
  Fly  1148 DDCNTMWRKKHTEKTNCGGCNLK---FEHPLYYRTHCSVFHD--------PSMSLTIRKYHCKVC 1201

  Fly   361 -RHTMARHLIGKHLISHYHFRRLQQQSRIRRQACLQEILKHMGSIVRQSPFQCMPC-RFYANTEE 423
             ...:.:..|.||...                       ||.|    :..:||..| :|:...  
  Fly  1202 GEPVLGKDNIMKHAAE-----------------------KHDG----KGAYQCQFCSKFFLRL-- 1237

  Fly   424 TFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNNSMLLHLLDSSHKEVLLALNRSVPICIAQRR 488
                     .:||:.:    |:.|:     ||.                    |||.|:      
  Fly  1238 ---------NYLEMHR----TYGCA-----SNP--------------------NRSRPV------ 1258

  Fly   489 RIQCSRCGMEFLYNIQLRQHSITEHPGLALTGTAADEYQSRFRCNLCGSSQKSRLALQRHKK--H 551
               |..||.:|....:|:.|....|..:|       |....|:|.||.....||.|||||.|  |
  Fly  1259 ---CDFCGRKFCQPQKLKAHIKRMHSDMA-------EVLRDFQCKLCSKLLGSRAALQRHSKEVH 1313

  Fly   552 KHHLARYFCAICRLEFDNSLDARRH------------------------RSLVIHKQKAR--PQT 590
            ..:.....|..|:..|.|..:.:.|                        :.|..|.:|..  .|.
  Fly  1314 SRNSTVVSCPRCQKLFQNRSNLKIHMLTHSGVRPFKCAEPECNAAFTTKQCLQFHYKKVHNYTQE 1378

  Fly   591 SIPQPENEIEH--------MLREVL-EETVPSPPA---------KRSADVNAKCS-------NSR 630
            .:|:.|..:.:        |..:.| ::|..:.||         :.:|.|.:..|       ..|
  Fly  1379 QMPKIERSVAYTFDAYSGGMKVDFLGKQTATATPASAASAQAQPRPNAAVVSPSSFTEQAPRRRR 1443

  Fly   631 KTIE--SSQRLAQHQAEVHSSDNH--------------LC------------------------- 654
            |::|  ||......|::...||::              ||                         
  Fly  1444 KSLEDQSSMLSGSLQSDAEFSDDNLFEAIKKSGKSIKDLCRNEPNLSLLSSKISSIFGDKVPSAT 1508

  Fly   655 --LSCGISFESAQALGRHTRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYE----SDLVYH 713
              ||..:|..::....:..|..:|:........|.|.|::......|.:.|.|::    ..|.:.
  Fly  1509 ASLSASVSAVASSGARKRKRKKEPVVPAQQQLHLHQQQQQQQQQQQQSQHQQQHQQQHAQQLQHQ 1573

  Fly   714 RI--------------FHTRSGTIGKNEVLQCPLCPKNFKKHSLRAHLRNHTNEKIFECTECLQK 764
            ::              .|.:...:..:...|.|    .:..|.|.||...|..::  :..:..|:
  Fly  1574 QLQQQHAQQHQQQQHHLHQQHQQLHHDPQQQHP----QYHPHQLHAHALPHQQQQ--QQQQQQQQ 1632

  Fly   765 FARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVE 829
            ..:.|...:....::|::....:|:.|...:.:|   :...|..:|.|::...::  ::.:.|| 
  Fly  1633 QQQLHGDPDDEEVENARLEQVRRKQNAQLSLVES---FLTTTAQRLSAQQQVQQV--VAAAAAV- 1691

  Fly   830 RNYLCHFADCSYAGRTPESLKTHLVSH-------------------------------SQENHKC 863
                   :..:.||..|..| .|::.|                               |...|  
  Fly  1692 -------SAMAGAGEDPAKL-GHMMGHMGVGVGVGMDEEEDDDEDDDDGGGGGGGGGGSAVQH-- 1746

  Fly   864 ARINCSYVGKSELHLKRHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSGQKPHQCP 927
                         |...|...||                 .:.:..|...|. .||...|||.|
  Fly  1747 -------------HPHVHAHQAH-----------------HSHVHAHAHPHH-AHSHAHPHQHP 1779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 4/38 (11%)
C2H2 Zn finger 731..750 CDD:275368 5/19 (26%)
C2H2 Zn finger 758..779 CDD:275368 2/21 (10%)
C2H2 Zn finger 804..824 CDD:275368 3/20 (15%)
C2H2 Zn finger 834..856 CDD:275368 5/22 (23%)
C2H2 Zn finger 898..918 CDD:275368 2/20 (10%)
zf-H2C2_2 910..935 CDD:290200 8/19 (42%)
C2H2 Zn finger 926..945 CDD:275368 1/3 (33%)
C2H2 Zn finger 957..984 CDD:275368
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 26/146 (18%)
C2H2 Zn finger 1198..1219 CDD:275368 6/44 (14%)
C2H2 Zn finger 1227..1255 CDD:275368 11/68 (16%)
C2H2 Zn finger 1259..1280 CDD:275368 6/21 (29%)
C2H2 Zn finger 1292..1313 CDD:275368 11/21 (52%)
C2H2 Zn finger 1322..1342 CDD:275368 5/20 (25%)
zf-H2C2_2 1334..1361 CDD:290200 1/27 (4%)
C2H2 Zn finger 1350..1373 CDD:275368 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.