DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and CG3032

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster

Alignment Length:607 Identity:116/608 (19%)
Similarity:193/608 (32%) Gaps:249/608 (41%)


  Fly   259 VPGSKQLEYRENLDLTK--LDQPGASYWC-NICCRRLKSRLYYNQHLRSGYHIKRAEAECELEQA 320
            :|.|::|:...|::|::  .:|.....|. |..|...:|.:...:..|      |...||..:..
  Fly    35 IPISQELQQLLNINLSQDVENQDADQQWLPNELCLECRSAVQNFEKFR------RKADECRKQLL 93

  Fly   321 TL----GRELTLSKDFSIKDDADKN-------EPKP---------------PKRQRRA--NLLRC 357
            .:    .||.|....:..:::..::       ||.|               |::..|.  |.|:|
  Fly    94 EMLKKDPREPTFEVVYDGREEDQESLHGLEPPEPAPDPDPIDEPAIKSDKSPRKSFRGSRNTLKC 158

  Fly   358 DLCRHTMARHLIGKHLISHYHFRRLQQQSRIRRQACLQEILKHMGSIVRQSPFQCMPCRFYANTE 422
            .:||.:.|..:.   |.:|           ||:        .|.||   :.||||..|      |
  Fly   159 SVCRRSFAHQIT---LAAH-----------IRK--------VHEGS---KRPFQCDQC------E 192

  Fly   423 ETFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNNSMLLHLLDSSHKEVLLALNRSVPICIAQR 487
            :.:.:             :||.:                .|:.:               :...:.
  Fly   193 KAYSF-------------MGGLY----------------THIRE---------------VHAPKE 213

  Fly   488 RRIQCSRCGMEFLYNIQLRQHSITEHPGLALTGTAADEYQSRFRCNLCGSSQKSRLALQRHKKHK 552
            ||..|.:.|.|.:|.                                      ||:|:|:||:.|
  Fly   214 RRHPCDQPGCERIYT--------------------------------------SRIAMQKHKRLK 240

  Fly   553 HH------LARYFCAICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPENEIEHMLREVLEETV 611
            |.      |.::.|..|...|:.|.:.:.|.           :|..| .|:|:            
  Fly   241 HSPRDRDALKKFICEQCGASFNQSANLKYHL-----------KTKHP-TEDEV------------ 281

  Fly   612 PSPPAKRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSDNHLCLSCGISFESAQALGRHTRSCQP 676
                |.|                          |..:.:.|.|..|...|.|...|..||     
  Fly   282 ----AAR--------------------------EGGAGERHFCDICQKEFHSRYTLKYHT----- 311

  Fly   677 LASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIGKNEVLQCPLCPKNF-KK 740
                   ....:.|::..:.|..|..:...:..|:.|.:.|:       |:.|.|..|.:.| ::
  Fly   312 -------LQQHEVQEELPHECQVCGRRMAKKFMLLQHMLMHS-------NDKLPCEHCGRRFARR 362

  Fly   741 HSLRAHLRN-HTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQSKPKYQC 804
            ..|.||:|. |...|.|.|..|.:.||.|..|::|   ::...|:|               .|.|
  Fly   363 FELEAHVRAVHLKLKPFPCHHCPESFASRKTLRHH---EYIHTGEK---------------PYIC 409

  Fly   805 GTCGKLLAKKYSLKLHEISHSK 826
            .|||:...::..||.|...|.|
  Fly   410 DTCGQAFRQQTCLKNHRKVHEK 431

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 4/20 (20%)
C2H2 Zn finger 731..750 CDD:275368 7/21 (33%)
C2H2 Zn finger 758..779 CDD:275368 7/21 (33%)
C2H2 Zn finger 804..824 CDD:275368 7/20 (35%)
C2H2 Zn finger 834..856 CDD:275368
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 14/66 (21%)
C2H2 Zn finger 158..179 CDD:275368 8/43 (19%)
C2H2 Zn finger 188..209 CDD:275368 6/71 (8%)
C2H2 Zn finger 218..239 CDD:275368 10/59 (17%)
C2H2 Zn finger 254..275 CDD:275368 6/32 (19%)
C2H2 Zn finger 294..315 CDD:275368 7/33 (21%)
C2H2 Zn finger 325..345 CDD:275368 4/20 (20%)
C2H2 Zn finger 352..373 CDD:275368 7/21 (33%)
C2H2 Zn finger 381..401 CDD:275368 7/23 (30%)
C2H2 Zn finger 409..429 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.