DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and Zfp407

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:XP_008770443.2 Gene:Zfp407 RGDID:1310645 Length:2255 Species:Rattus norvegicus

Alignment Length:1352 Identity:264/1353 (20%)
Similarity:413/1353 (31%) Gaps:542/1353 (40%)


  Fly     5 HLEDTH----LCIRCNATILGLSK--YIDHR---KRNCLITGKQNASPKTDGRTRISADTHVSAT 60
            |:::.|    .|..||   |.||:  ..:||   ..|.|:     ..|||  .:.:|.|:.:..:
  Rat   599 HMKEKHGMGFFCTSCN---LFLSERDVEEHRATEAHNSLV-----VQPKT--ASSLSRDSVLPLS 653

  Fly    61 LISSSNLDHSYDGFHFTEPEAPSSYLRKTAASHGG-----------------KTSKSLTEAYDLP 108
            .:.|.|:..|.:.......|.|:    ::.||||.                 ||..|......:.
  Rat   654 TLESDNMADSREDSGKASQEEPA----ESRASHGTEARHSSKPQFQCKKCFYKTRSSTVLTRHIK 714

  Fly   109 YELGADLFF--SSLQLQSVATGGKIGSVPRQERSKDESWSAPAGDPLLKAVRENDETVFKPLHFD 171
            ...|.|..|  .:..|.|::   |.|.....:|||.          |..|.:.|....|      
  Rat   715 LRHGQDYHFLCKACNLYSLS---KEGMEKHIKRSKH----------LENAKKNNIGLSF------ 760

  Fly   172 HEYPEASDEEDDEDEHEEFDAEEDEEEYDARRHSPPIVPASHTGGKWKPEQRPQLR---HPHIER 233
                      ::..|.....|.:.:||             |:..|..:||....:|   |.|.|:
  Rat   761 ----------EECIERVCIGANDKKEE-------------SNVSGSGRPEGHIGVRLQEHSHCEQ 802

  Fly   234 --LSPSWDEPPEENYTHPPADHTKGKWVPGSKQLEYRENLDLTKLDQPGA--------------- 281
              |:|                    |.:|.|..:...:.|.|....:.|.               
  Rat   803 SMLTP--------------------KELPQSGVITKEDELGLASTPKRGRPKGSISRTCSHCGLL 847

  Fly   282 -------------------SYWCNICCRRLKSRLYY-------NQHLRSGYHIKRAEAECE---- 316
                               ||.|.:|       .||       .:|..:..|..|.|.|..    
  Rat   848 ASSITNLTVHIRRKHSHQYSYLCKVC-------KYYTVTKGDMERHCATKKHKGRVEIEANGKHS 905

  Fly   317 --------------LEQATLGRELTLSKD---FSIKDDADKNEPKPPKRQRRANLLRCDLCRHTM 364
                          .:::||.  ||:|.:   .|.|.||.                       |:
  Rat   906 SDIIVGPEGGNLEACKKSTLA--LTVSDEQANKSAKSDAS-----------------------TL 945

  Fly   365 ARHLIGK-----------------HLISHYHFRR---------LQQQSRIRRQACLQEILKHMGS 403
            .:.::|.                 .:.|....::         |||..    .||.|.      .
  Rat   946 DKPVVGNGDTGDADAGSALQSVDGEVSSQLADKKGQIALETEDLQQHD----DACSQR------D 1000

  Fly   404 IVRQSPFQCMPCRFYANTEETFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNNSMLLHLLDSS 468
            :...|..:|:.|.|.|::..:...|.| .:|   ||..  .|:|..|.:.:.|...|..|.....
  Rat  1001 VAGSSDNKCLHCEFSAHSAASLELHVK-RKH---TKEF--EFYCMACDYYAVTRREMTRHAATEK 1059

  Fly   469 HK----EVLLALN-------RSVPICIAQRRRIQCSRCGMEFLYNIQLRQHSI-----TEHP--- 514
            ||    ..|.:.|       .|..|.|.:....|.|.   ||    |:..|..     :.||   
  Rat  1060 HKMKRQSYLSSSNVEAGSSEISKSITIPEEEHSQNSE---EF----QISPHQSSGTLQSRHPADC 1117

  Fly   515 GLALTGTAADEYQSRFRCNLCGSSQKSRLALQRHKKHKHHLARYFCAICR--LEFDNSLDARRHR 577
            .:....|..|  .|:.   ||.....:.:|.|....::.|   .||....  |..|.|:..|...
  Rat  1118 SILYDNTNLD--MSKV---LCAPDSVAVVAEQESNFNEDH---SFCETLHQPLAKDRSIKPREIV 1174

  Fly   578 SLVIHKQKARPQTSIPQPENEIEHMLREVLEETVPSPPAKRS-------ADVNAKCSNSRKTIES 635
            ||.....::.|  ...|..|        :....|.|..|||:       .|.:|.|.:...:::.
  Rat  1175 SLNTPSNRSSP--GCLQSGN--------LASSAVDSETAKRNHNLLDDVGDTSAHCEDEGGSLDG 1229

  Fly   636 SQRL------------AQHQAE--------------------------VHSSDNHLCLSCGISFE 662
            |:..            ..|.||                          ..:|::...:....:.|
  Rat  1230 SEEKVLDKSPCPGDLDGGHSAESISPVVVKIPREQLDLDGGGQSKVGCEQTSEDLKDVQANSNLE 1294

  Fly   663 SAQALGRHTRSCQPLASTSTPADLSQAQK--------------KSMYS----------------- 696
            |.:.|.......:.:.....||.:..|:.              ::|||                 
  Rat  1295 SKEILMNSQHEPEVILEEDAPASIGTAENNDAYETIISIDDKGQTMYSFGRFDSSIIRIKTEDGE 1359

  Fly   697 ---------------------------------------------CDQCRFQSQYESDLVYH-RI 715
                                                         ||.|.|.:...|.|..| .:
  Rat  1360 LVEQPEEGLMVTGGKVSELPLKDCAQGLKKKKVEGSSFGESTRIRCDDCGFLADGLSGLNVHIAM 1424

  Fly   716 FHTRSGTIGKNEVLQCPLCPKNF------KKHSLRA-HLRNH--TNEKI------FECTECLQKF 765
            .|..     |.:...|.||.|:|      .:|...| |:||.  :.|::      |:|.:|.:.|
  Rat  1425 KHPT-----KEKHFHCLLCGKSFYTESNLHQHLASAGHMRNEQASVEELPEGGATFKCVKCTEPF 1484

  Fly   766 ARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQ--------------------------------- 797
            ....||..|:..:|.:: .:|..||..:|.||                                 
  Rat  1485 DSEQNLFLHIKGQHEEL-LREVNKYIVEDTEQINREREENQGNVCKYCGKMCRSSNSMAFLAHIR 1548

  Fly   798 ----SKP---------------------------KYQCGTCGKLLAKKYSLKLHEI-SHSKAV-- 828
                |||                           :|:|..||.....|..|..|.: .|....  
  Rat  1549 THTGSKPFKCKICHFATAQLGDARNHVKRHLGMREYKCHVCGVAFVMKKHLNTHLLGKHGVGTPK 1613

  Fly   829 ERNYLCHFAD----------------------------CSYAGRTPESLKTHLVSHSQENHKCAR 865
            ||.:.||..|                            |.|:..|..::|.|..:|:.|......
  Rat  1614 ERKFTCHLCDRSFTEKWALNNHVKLHTGEKPFKCTWPTCHYSFLTASAMKDHYRTHTGEKSFLCD 1678

  Fly   866 INCSYVGKSELHLKRHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSGQKPHQCPHCD 930
            : |.:.|.:     ||..:.|..:..||:.|.||:|:|.:..:.||.||...|:|:||::||.||
  Rat  1679 L-CGFAGGT-----RHALTKHRRQHTGEKPFKCDECNFASTTQSHLTRHKRVHTGEKPYRCPWCD 1737

  Fly   931 FQCSTIDNLRKHIIKTGKHPGMFIYHCAKCSDEEAGEIFKSNSYKEYQHHLK 982
            ::.:..:|:||||:.||||.|:.:|:|.||.       :.:|...|:::|||
  Rat  1738 YRSNCAENIRKHILHTGKHEGVKMYNCPKCD-------YGTNVPVEFRNHLK 1782

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 7/21 (33%)
C2H2 Zn finger 731..750 CDD:275368 10/26 (38%)
C2H2 Zn finger 758..779 CDD:275368 6/21 (29%)
C2H2 Zn finger 804..824 CDD:275368 6/21 (29%)
C2H2 Zn finger 834..856 CDD:275368 8/50 (16%)
C2H2 Zn finger 898..918 CDD:275368 8/20 (40%)
zf-H2C2_2 910..935 CDD:290200 12/25 (48%)
C2H2 Zn finger 926..945 CDD:275368 9/19 (47%)
C2H2 Zn finger 957..984 CDD:275368 8/27 (30%)
Zfp407XP_008770443.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BBQU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.