DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and ZNF780A

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:XP_024307222.1 Gene:ZNF780A HGNCID:27603 Length:658 Species:Homo sapiens

Alignment Length:822 Identity:168/823 (20%)
Similarity:272/823 (33%) Gaps:260/823 (32%)


  Fly   217 KW---KPEQRPQLRHPHIERLSPSWDEPPEENYTHPPADHTKGKWVPGSKQLEYRENLDLTKLDQ 278
            :|   :|:||...|...:            |||:|..:       :.||.    ....|:..|.:
Human    35 EWECLQPDQRTLYRDVML------------ENYSHLIS-------LAGSS----ISKPDVITLLE 76

  Fly   279 PGASYWCNICCRRLKSRLYYNQHLRSGYHIKRAEAECELEQATLGREL------TLS-KDFSIKD 336
            .....|  :..|:..||.|.:..|:  |..::...|.:..:..|.:::      ||. :.|..::
Human    77 QEKEPW--MVVRKETSRRYPDLELK--YGPEKVSPENDTSEVNLPKQVIKQISTTLGIEAFYFRN 137

  Fly   337 DADKNEPKPPKRQRRANLLRCDLCRHTMARHLIGKHLISHYHFRRLQQQSRIRRQACLQEILKHM 401
            |::..:.:..:..:..|:.:..:....:..|.....||.:.|                       
Human   138 DSEYRQFEGLQGYQEGNINQKMISYEKLPTHTPHASLICNTH----------------------- 179

  Fly   402 GSIVRQSPFQCMPCRFYANTEETFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNNSMLLHLLD 466
                  .|::|..|..|.:.....:.|...|                                  
Human   180 ------KPYECKECGKYFSRSANLIQHQSIH---------------------------------- 204

  Fly   467 SSHKEVLLALNRSVPICIAQRRRIQCSRCGMEFLYNIQLRQHSITEHPGLALTGTAADEYQSRFR 531
                              ...:..:|..||..|..:||..:|. ..|.|           :..|.
Human   205 ------------------TGEKPFECKECGKAFRLHIQFTRHQ-KFHTG-----------EKPFE 239

  Fly   532 CNLCGSSQKSRLALQRHKKHKHHLARYFCAICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPE 596
            ||.||.:......|.|||........:.|..|...|:.|.:..:|:|  || ...:|.       
Human   240 CNECGKAFSLLTLLNRHKNIHTGEKLFECKECGKSFNRSSNLVQHQS--IH-SGVKPY------- 294

  Fly   597 NEIEHMLREVLEETVPSPPAKRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSDN-HLCLSCGIS 660
                                        :|....|.......|.||| ::||::. .:|..||::
Human   295 ----------------------------ECKECGKGFNRGAHLIQHQ-KIHSNEKPFVCKECGMA 330

  Fly   661 FESAQALGRHTRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIGK 725
            |.....|..|   ||          :...:|.  :.|.:|.......:.||.|:..||      .
Human   331 FRYHYQLIEH---CQ----------IHTGEKP--FECKECGKAFTLLTKLVRHQKIHT------G 374

  Fly   726 NEVLQCPLCPKNFK-KHSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHV-------------- 775
            .:..:|..|.|.|. .:.|..|...||.||.|||.||.:.|.|..||..|.              
Human   375 EKPFECRECGKAFSLLNQLNRHKNIHTGEKPFECKECGKSFNRSSNLVQHQSIHAGIKPYECKEC 439

  Fly   776 ---------ITKHAKVGDKEKK----------KYAAKDVEQS------KPKYQCGTCGKLLAKKY 815
                     :.:|.|:...||.          :|..:.:|.|      || ::|..|||...:..
Human   440 GKGFNRGAHLIQHQKIHSNEKPFVCRECEMAFRYHCQLIEHSRIHTGDKP-FECQDCGKAFNRGS 503

  Fly   816 SLKLHEISHSKAVERNYLCHFADCSYAGRTPESLKTHLVSHSQEN-HKCARINCSYVGKSELHLK 879
            ||..|:..|:.  |:.|.|  .:|..|.|....|..|..:|:.|. .:|.  .|....:...:|.
Human   504 SLVQHQSIHTG--EKPYEC--KECGKAFRLYLQLSQHQKTHTGEKPFECK--ECGKFFRRGSNLN 562

  Fly   880 RHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSGQKPHQCPHCDFQCSTIDNLRKHII 944
            :| :|.|:    |::.|.|.:|....|:..||.||...|:|:||.:|.    :|.....|...:|
Human   563 QH-RSIHT----GKKPFECKECGKAFRLHMHLIRHQKLHTGEKPFECK----ECGKAFRLHMQLI 618

  Fly   945 KTGK-HPGMFIYHCAKCSDEEAGEIFKSNSYKEYQHHLKTHK 985
            :..| |.|...:.|.:|     |::|...:      .|..||
Human   619 RHQKLHTGEKPFECKEC-----GKVFSLPT------QLNRHK 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 5/20 (25%)
C2H2 Zn finger 731..750 CDD:275368 6/20 (30%)
C2H2 Zn finger 758..779 CDD:275368 8/44 (18%)
C2H2 Zn finger 804..824 CDD:275368 7/20 (35%)
C2H2 Zn finger 834..856 CDD:275368 6/22 (27%)
C2H2 Zn finger 898..918 CDD:275368 7/20 (35%)
zf-H2C2_2 910..935 CDD:290200 10/25 (40%)
C2H2 Zn finger 926..945 CDD:275368 4/19 (21%)
C2H2 Zn finger 957..984 CDD:275368 5/27 (19%)
ZNF780AXP_024307222.1 KRAB 22..83 CDD:214630 14/73 (19%)
C2H2 Zn finger 184..204 CDD:275368 4/20 (20%)
zf-H2C2_2 196..220 CDD:316026 6/76 (8%)
C2H2 Zn finger 212..232 CDD:275368 7/21 (33%)
COG5048 236..612 CDD:227381 110/452 (24%)
C2H2 Zn finger 240..260 CDD:275368 8/20 (40%)
C2H2 Zn finger 268..288 CDD:275368 7/22 (32%)
C2H2 Zn finger 296..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 324..344 CDD:275368 8/33 (24%)
C2H2 Zn finger 352..372 CDD:275368 5/20 (25%)
C2H2 Zn finger 380..400 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..428 CDD:275368 8/20 (40%)
C2H2 Zn finger 436..456 CDD:275368 2/20 (10%)
C2H2 Zn finger 464..484 CDD:275368 3/20 (15%)
C2H2 Zn finger 492..512 CDD:275368 7/20 (35%)
C2H2 Zn finger 520..540 CDD:275368 6/22 (27%)
C2H2 Zn finger 548..568 CDD:275368 5/23 (22%)
C2H2 Zn finger 576..596 CDD:275368 7/20 (35%)
C2H2 Zn finger 604..624 CDD:275368 5/24 (21%)
C2H2 Zn finger 632..652 CDD:275368 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.