DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and Opbp

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster

Alignment Length:637 Identity:128/638 (20%)
Similarity:215/638 (34%) Gaps:187/638 (29%)


  Fly   266 EYRENLDLTKLDQPGASYWCNICCRRLKSRLYYNQHLRSGYHIKRAEAECELEQATLGRELTLSK 330
            |..|:.|.....|.|       ||......|.:         |:....:|..|:  :|.|..:..
  Fly    41 EDTESYDRAHGPQAG-------CCTGASGELDF---------IEEVAEDCISEE--VGEEDIVYA 87

  Fly   331 DF-----------SIKDDADKNEPKPPKRQRRANLLRCDLCRHTM--ARHLIGKHLISHYHFRRL 382
            |.           ::|.:.|:|||....|      ..|..| |::  .|:...:|:.........
  Fly    88 DVPLWELVEEVPANVKAEKDQNEPSNSDR------YFCYDC-HSIFENRNKAEEHICPRAESGGS 145

  Fly   383 QQQ-----SRIRRQACLQEILKHMGSIVRQSPFQCMPCRFYANTEETFLYHWKSHEHLELTKRLG 442
            .||     :.:||:  |..:....|.....|...|..|....::|:...:|.:.||         
  Fly   146 SQQDGDAKAPVRRK--LASVSARTGPRDASSVISCGICNTVFSSEKFLKFHMRIHE--------- 199

  Fly   443 GTFWCSFCQFNSNTNNSMLLHLLDSSHKEVLLALNRSVPICIAQRRRIQCSRCGMEFLYNIQLRQ 507
                                              ||:                           .
  Fly   200 ----------------------------------NRA---------------------------P 203

  Fly   508 HSITEHPGLALTGTAADEYQ--SRFRCNLCGSSQKSRLALQRHKKHKHHLARYFCAICRLEFDNS 570
            .||.:    ||...|..:|.  .:|.|.:|..|....|.....:.|:...:...|:||..:|:|.
  Fly   204 KSIQD----ALPIGAHQQYSELDQFYCEICNKSFDETLLTVHKQMHQQESSEIMCSICNRKFENE 264

  Fly   571 LDARRHRSLVIHKQKARPQTSIPQPENEIEHMLREVLEETVPSPPAKRSADVNAKCSNSRKTIES 635
            :..:.|:.  ||:   :|:.|    |:..:...|..|::..|..|          |....:....
  Fly   265 VTYQMHQK--IHE---KPRDS----ESSRKLAQRTSLDKEKPGFP----------CQYCERVFTR 310

  Fly   636 SQRLAQHQAEVHSSDN-HLCLSCGISFESAQALGRHTR---SCQPLASTSTPADLSQAQKKSMYS 696
            .....:|: .||:.:. :.|..||.:|..:.:|..|.|   :.:|                  |.
  Fly   311 PFEKVKHE-RVHTGEKPYACEVCGKTFRVSYSLTLHLRTHTNIRP------------------YV 356

  Fly   697 CDQC--RFQSQYESDLVYHRIFHTRSGTIGKNEVLQCPLCPKNFKKH-SLRAHLRNHTNEKIFEC 758
            |..|  ||:|        |:::..............|..|||.|:.. .|.||...||  |.:.|
  Fly   357 CTVCNKRFKS--------HQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAHKNTHT--KPYRC 411

  Fly   759 TECLQKFARRHNLKNHVITKHAKVGDK-------EKKKYAAKDVEQSKPKYQCGTCGKLLAKKYS 816
            ..|.:.|:..:.:|||:.| |.::..|       ...|.||....|:..|:.|.|||...|:.::
  Fly   412 AVCNRPFSSMYAVKNHMQT-HKEISSKGSVGSGTPNIKSAATSKSQAAGKFYCNTCGAEYARLFA 475

  Fly   817 LKLH-EISHSKAVERNYLCHFADCSYAGRTPESLKTHLVSHSQENHKCARIN 867
            |:|| :.:|....|:.......|.::...|.:|....|::.::.:  .|.||
  Fly   476 LRLHMKSAHGLVEEQENPATSTDAAHVAETDDSETAVLIAAAEAD--AAYIN 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 6/22 (27%)
C2H2 Zn finger 731..750 CDD:275368 8/20 (40%)
C2H2 Zn finger 758..779 CDD:275368 7/21 (33%)
C2H2 Zn finger 804..824 CDD:275368 8/21 (38%)
C2H2 Zn finger 834..856 CDD:275368 4/22 (18%)
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 7/22 (32%)
C2H2 Zn finger 301..321 CDD:275368 3/21 (14%)
zf-H2C2_2 316..336 CDD:290200 6/21 (29%)
C2H2 Zn finger 329..349 CDD:275368 7/20 (35%)
zf-H2C2_2 341..366 CDD:290200 9/43 (21%)
C2H2 Zn finger 357..377 CDD:275368 6/28 (21%)
C2H2 Zn finger 385..405 CDD:275368 8/20 (40%)
C2H2 Zn finger 411..431 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.