DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and unc-98

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_509284.2 Gene:unc-98 WormBaseID:WBGene00006827 Length:310 Species:Caenorhabditis elegans

Alignment Length:327 Identity:66/328 (20%)
Similarity:108/328 (33%) Gaps:74/328 (23%)


  Fly   572 DARRHRSLVIHKQKARPQTSIPQPENEIEHML------------------REVLEETVPSPPA-- 616
            :||:.|........|.....:....||:.|.|                  :|:::...|:..|  
 Worm     8 EARKERDDFEELMNACDLAKMSVKNNEMVHGLETFGINGESSENGNKEKPKEIMKVVAPTVEAYV 72

  Fly   617 -KRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSDN----HLCLSCGISFESAQALGRHTRSCQP 676
             ..||....|.|.........|.:.|....|...||    :.|..||::|.....|..|.|.   
 Worm    73 GSSSAQTPTKSSGGALDGSDQQEVRQDGTSVQKDDNGFVFYKCRFCGLTFNFMNTLRAHERI--- 134

  Fly   677 LASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIGKNEVLQCPLCPKNFKKH 741
                   .|:||.     |.|.:|....::...|.||...|:      :.:..:|. |.:.|..:
 Worm   135 -------HDVSQP-----YVCGKCGDSFEFACQLEYHAAQHS------EIDGYKCE-CGRTFFSY 180

  Fly   742 SLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQSKPKYQCGT 806
            :...: ..||::.:                  .:|........|..||......||..|:....|
 Worm   181 TEMLY-HKHTDDPL------------------ELIGAPETTTIKVSKKRVLPVSEQDLPQPAFVT 226

  Fly   807 CGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPESLKTHLVSHSQENHKCARINCSYV 871
            .|  ...|:.|:::....||.    |:|.:...||:  ....|..|:.||..|.:...|.:...:
 Worm   227 EG--YEPKHPLRVYNDVRSKP----YICEYCSKSYS--DSRGLAYHMYSHRGEKYFNPRASRYMM 283

  Fly   872 GK 873
            |:
 Worm   284 GR 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 5/20 (25%)
C2H2 Zn finger 731..750 CDD:275368 3/19 (16%)
C2H2 Zn finger 758..779 CDD:275368 1/21 (5%)
C2H2 Zn finger 804..824 CDD:275368 4/20 (20%)
C2H2 Zn finger 834..856 CDD:275368 6/22 (27%)
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
unc-98NP_509284.2 C2H2 Zn finger 115..135 CDD:275368 7/30 (23%)
C2H2 Zn finger 143..163 CDD:275368 5/20 (25%)
SFP1 <169..268 CDD:227516 25/127 (20%)
C2H2 Zn finger 171..189 CDD:275368 4/20 (20%)
C2H2 Zn finger 248..268 CDD:275368 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.