DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and znf644b

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:XP_003198829.2 Gene:znf644b ZFINID:ZDB-GENE-120214-23 Length:1267 Species:Danio rerio

Alignment Length:1053 Identity:193/1054 (18%)
Similarity:337/1054 (32%) Gaps:284/1054 (27%)


  Fly    32 NCLITGKQNASPKTD-----GRTRISADTHVSATLISSSNLDHSYDGFHFTEPEA---PSSYLRK 88
            |..:.|...|:|.|:     |.....|.:|.::...|..|.|.|......|.||.   ||.....
Zfish    90 NPFVCGSVPAAPSTNDSLPSGALVNGAASHCTSEESSVHNKDMSPLPGTDTSPEVLPPPSELQSD 154

  Fly    89 TAASHGG-----KTSKSLTEAY----DLPYE--LGADLFFSSLQLQSVATGGKIGSV-----PRQ 137
            |.....|     :::::.:|:.    :.|.:  :|..|....:.......|.|.|.:     ...
Zfish   155 TRQKAEGCALKVRSARASSESNYSDGEAPLDVLVGEGLDNRPISRLLSRKGIKAGCLWDFDSELS 219

  Fly   138 ERSKDE----SW------------SAPAGDPLLKAVRENDETVFKPLHFDHEYPE--ASDEEDDE 184
            |.|.|:    :|            |:.|||.:...| |.|.|  .|.:......:  |.:..|:|
Zfish   220 ESSSDDCDGLNWGLQEKFMRILLNSSVAGDGVRTKV-EIDGT--PPANRRRRMRKNCAMERADNE 281

  Fly   185 DE-HEEFDAEEDEEEYDARRHSPPIVPASHTGGKWKPEQRPQLRHPHIERL---SPSWDE----P 241
            .| ::.||........|....|...:...|...| :||.........:|:.   |.:..|    .
Zfish   282 VEVYDGFDYASQISLTDKESDSESSINKEHAFRK-EPESLKAYAGLRLEKFCDKSAAMKELISSE 345

  Fly   242 PEENYTHPPADHTKGKWVPGSKQLEYRENLDLTKLDQPGASYWCNICCRRLKSRLYYNQHLRSGY 306
            .||......:|.....:: |.|....:..   ||..:..:.:.|:.|....|.:.:.::|:.  |
Zfish   346 KEERCDEGGSDVETNTYM-GEKLARLKTE---TKTGEELSFFPCSKCNETFKEKRHLHRHMM--Y 404

  Fly   307 HIKRAEAECELEQATLGRELTLSKDFSIKDDADKNEPKPPKRQRRANLLRCDLCRH--TMARHL- 368
            |:                              |:|     .:.|:.::.|..:||.  ...|.| 
Zfish   405 HL------------------------------DRN-----NKVRQEHVPRPFICRECGRSFRDLT 434

  Fly   369 -IGKHLISHYHFRRLQQQSRIRRQACLQEILKHMGSI---VRQSPFQCMPCRFYANTEETFL--- 426
             :.||:|.|          ::||:..::|| |....|   .|::..||..|.|.....:||:   
Zfish   435 SLQKHMIIH----------QVRRERLMEEI-KGFSKIDVEGRRACLQCPQCVFGTKCPKTFIRCG 488

  Fly   427 --------------YHW-----KSHE---HLELTKRLGGTFWCSFCQFNSNTNNSMLLHL----- 464
                          :|.     ::||   |.....:....|.|..|.|.||...|...|:     
Zfish   489 KTNEKEKPYCFEDCHHMTKSEVEAHECTAHHNTCAKTEDCFACQNCTFTSNNRFSFRKHVELIHR 553

  Fly   465 --------------LDSSHKEVLLALNRSVPICIAQRRRIQCSRCGMEFLYN----IQLRQHSIT 511
                          :|...|...|:|  .:|...:..:.....|..:.|..|    :.:|.....
Zfish   554 QPYYDDYEPQPHSNVDDQPKTKDLSL--PMPKIQSTEKWSVKDRGELPFRPNGSADLNVRSEETQ 616

  Fly   512 EH-PGLALT------GTAADEYQSRFRCNLCGSSQKSRLALQRHKKHKHHLARYFCAICRLEFDN 569
            :. .|.:|:      |:.|::. |.|...   |.:.|:|:....:|........:......|:::
Zfish   617 KACDGFSLSLIKWSPGSPANKL-SPFSLR---SDKPSKLSPLPTEKIDVTTGLPYVEEDNQEYES 677

  Fly   570 SLDARRHRSLVIHKQKARPQTSIPQPENEIEHMLREVLEETVPSPPAKRSADVNAKCSNSRKTIE 634
            ::..:|.:.|.........:|.|...        ...|.....|.|...|..........|..|.
Zfish   678 TVSEKRTKYLSSFDAHLTAKTEIVSK--------AACLNPGTESRPKDPSTSSTLALQTLRHKIP 734

  Fly   635 SSQRLAQHQAEVHSSDNHLCL-SC--------------GISFESAQALGRHTRSCQPLASTSTPA 684
            |.::::......|:...|:.| .|              |..:|.||...:.|:.......::||:
Zfish   735 SKRKMSIPYRNTHADIPHVSLPECESESPQWDSSTPQEGDDYEGAQDFSKCTKESPDWFQSNTPS 799

  Fly   685 DL--------------SQAQKKSMYSCDQCRF------------------QSQYESDLVYHRIFH 717
            |.              |..:.......|:.|.                  :|.|:....|.:...
Zfish   800 DYFIPFNNNIPDYASHSNPEDSIEEDSDEIRTFIIKEECIESTISEDNPDESVYQQSDPYGQYVV 864

  Fly   718 TRSGTIGKNEVLQCPLCPKNFKKH-SLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAK 781
            :....:|:.   .||.||..|:.. .|..|:|.|           |.:....::.::.|..:...
Zfish   865 SPFSVVGRK---CCPYCPAVFESGVGLSNHVRGH-----------LYRVGLSYDARHVVSPEQVA 915

  Fly   782 VGDKEKK---------KYAAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVERNYLCHFA 837
            ..|::.:         :...||..:||.::.|..|......|..|..|...|.|.:.:       
Zfish   916 SQDRQPRIRRKIPSVNRRIRKDKPESKTEHTCPLCLGWFDTKTGLSNHVRGHLKRIGK------- 973

  Fly   838 DCSYAGRTPESLKTHLVSHSQENHKCARI-----------------NCS--YVGKSELHLKRHLK 883
            ..|.|.::|.|:.:.|:....|.....|:                 :|.  ::..|.:.:|.|  
Zfish   974 PISGASKSPLSILSELLQDETEYKNIMRVFGSRPQLSKPFVSRKFASCDGLFLTSSGIPMKIH-- 1036

  Fly   884 SAHSTEKNGE-EW 895
              |.|.|..| .|
Zfish  1037 --HGTSKPDEGHW 1047

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 5/38 (13%)
C2H2 Zn finger 731..750 CDD:275368 8/20 (40%)
C2H2 Zn finger 758..779 CDD:275368 2/21 (10%)
C2H2 Zn finger 804..824 CDD:275368 5/20 (25%)
C2H2 Zn finger 834..856 CDD:275368 5/22 (23%)
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
znf644bXP_003198829.2 C2H2 Zn finger 385..405 CDD:275370 5/22 (23%)
zf-C2H2 421..443 CDD:306579 7/22 (32%)
C2H2 Zn finger 423..443 CDD:275370 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.