DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and znf644a

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_001265183.1 Gene:znf644a ZFINID:ZDB-GENE-030131-6244 Length:1169 Species:Danio rerio

Alignment Length:1281 Identity:237/1282 (18%)
Similarity:388/1282 (30%) Gaps:497/1282 (39%)


  Fly    54 DTHVSATLISS---SNLDHSYDGFHFTEPEAPSSYLRKTAASHGGKTSKSLTEAYDLPYELGADL 115
            :..:|.:.||.   ||...|.:|                  :..|.:...|.|..:|..:.| ||
Zfish    12 ENDISMSSISQDLLSNQSFSVEG------------------TTSGPSVHCLHETMELLSDQG-DL 57

  Fly   116 FFSSLQLQSVATGGKI--------------------------GSVPRQ---ERSKDESWSAPAGD 151
            ..|...:.|:.:.|..                          |.:|:.   :.|...:......|
Zfish    58 LSSVSFIDSICSDGPAKAAYVNGSTSPHISDEILLDISKNVPGFLPKSLHAQNSVTTNVHFEGAD 122

  Fly   152 PLLKAVRENDETVFKPL-----------HFDHEYPEAS-DEEDDE----------------DEHE 188
            ||.|   |.:.|:.:.|           .||:|.|||| |..||.                |:..
Zfish   123 PLRK---EGEITIRQTLTAEDVENRGIWGFDNESPEASLDNYDDANDLGWNPQREFMKFLWDDDN 184

  Fly   189 EFDAEEDEEEYDA-----RRHSPPIVPASHTGGKWKPEQRPQLRHPHIERLSPSWDEPPEENYTH 248
            ..|.||......:     ||...|||           .:|.:.:...:.::.|| ::|..:....
Zfish   185 GLDIEEKLSPVPSPINQKRRVPSPIV-----------HKRRRRKEKLVLKVDPS-EDPFSDLNLD 237

  Fly   249 PPADHTKGKWVPG-SKQLEY------RENLDLTKLDQPGASYWCNICCRRLKSRLYYNQHLRSGY 306
            ...||      || ...:|:      |.....:||..|           .:|:..|:|....:..
Zfish   238 SKQDH------PGEGSPIEFGPVKKTRSPRKPSKLQSP-----------IVKNTKYFNGTAEAVK 285

  Fly   307 HIKRAEAECEL---EQATLGRELTLSKDFS----IKDDADKNEPKPPKRQRRAN----------L 354
            |:....|:..|   ::..|.|| |||.|..    .:.:.|..|....:.|...|          .
Zfish   286 HLFPKPAKKPLSKTQKIGLIRE-TLSSDSEGPTFFQQNNDFKEKSLGQNQITCNKDTTSSKPFVC 349

  Fly   355 LRCDLCRHTMARHLIGKHLISHY-HFRRLQQQSRIRRQACLQEILKHMGSIVRQSPFQCMPCRFY 418
            ..|..|.:.  |..:..|:..|. ..::|.|..:|:.:.             :.:..||..|.|.
Zfish   350 KECGQCYYD--RSSLLNHISVHQDKGKKLNQFHQIKDEG-------------KDAKLQCPQCNFG 399

  Fly   419 ANTEETFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNNSMLLHLLDSSHKEVLLALNRSVPIC 483
            .|...||:.|.|:||.   .||.   :.|:.|.|.....:.:..||.   ||..::..:.:|...
Zfish   400 TNCPNTFVQHAKTHEK---DKRY---YSCNKCDFVEMNEDDLRRHLY---HKHGVIGADHTVWKS 455

  Fly   484 IA-QRRRIQCSRCGMEF---------------LYNIQLRQHSITEHPGLALTGTAADE-----YQ 527
            .. |.|::..|.|...:               :...|:..||:          .:.||     .|
Zfish   456 DGFQERKVNKSPCLNSYSPSFERKTKNSVGNHVEEEQVNSHSL----------DSGDEEPPTTEQ 510

  Fly   528 SRFRCNLCGSSQKSRLALQR------HKKHKHHLARYFCAICRLE---FDNSLDARRHRSLVIHK 583
            |...||:..|..|.:....|      ....:::|:...|.:.|.:   .::.||...|..|...|
Zfish   511 SFSACNVLTSCAKPKARSPRLLVKFGAPDEENNLSNDKCGLLRKKKRVGESKLDKSIHTLLSRKK 575

  Fly   584 QKARPQTSIPQPENEIEHMLREVLEETV---------PSPPA---KRSA-------------DVN 623
            ::.:..:.|...:...:...:|.|:.::         .|||:   ||||             |||
Zfish   576 RRDKSGSEIDTHQEPAKSSTKEFLDRSLNCETTFSETSSPPSKYLKRSAHSKEGNTKRTSKFDVN 640

  Fly   624 AKCSN---------SRKTIESSQRLAQHQAEVHSSDNHLCL----SCGISFESAQALGRHTRSCQ 675
            ..||.         .::|::.|....:.....|:......|    .|...|:..||    ||..:
Zfish   641 VTCSEDAGKTHLGLEKQTLKKSPSKRKMSTPFHNMQGQDILLDFPKCRQKFKKPQA----TRRRK 701

  Fly   676 PLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIG---------------- 724
            .|.:.|   |:......:: ..::|.......:.||..|...::: ::|                
Zfish   702 VLINNS---DILSVSSDAL-GPEECEMDKNANARLVKRRSSSSKA-SLGASASHFERNHSSPRVL 761

  Fly   725 ------KNEVLQ--------------------CPLCPKNFKKH-SLRAHLRNH------------ 750
                  |:|.:.                    ||.||..|:.. ||..|:|.|            
Zfish   762 SVKDEYKDEEISESITAVKLEPSSDVETDLKGCPYCPAVFESGISLSNHIRGHLHRVGLKVRRAP 826

  Fly   751 -------TNEKI----------------------------------FECTECLQKFARRHNLKNH 774
                   .::|:                                  ..|..|.:.|..|..|.||
Zfish   827 VKSAVKVASDKVPPVRRQALSQVKTEEDTSQTDHPAELPTDCQQTELICPLCREWFDNRTGLSNH 891

  Fly   775 VITKHAKVG-------------------------------------------------------- 783
            |.....::|                                                        
Zfish   892 VRGHLKRLGKPTSTASKSPVIILKELMRDKKQFQLKLQVLEKKCRTTNTFYPVRLGNGLTFASTV 956

  Fly   784 -----DKEKKK-------YAAKDV----------EQSKPKYQCGTCGKLLA----KKYSLKLHEI 822
                 |||:||       ....|:          |::|.|:|..|..|.|:    |...|::|. 
Zfish   957 KRQKDDKEEKKRLEINKGSPPSDLIGILKKRRAHEEAKAKHQSLTAKKALSLTSGKDCGLEIHT- 1020

  Fly   823 SHSKAV----------ERNYLCHFADCSYAGRTPESLKTHLVSHSQENHKCARINCSYVGKSELH 877
              .|||          :||...|   |:.:..:..||..||..:||...|..:...:        
Zfish  1021 --CKAVPSSPGEKGDNKRNVCVH---CNASFHSGISLSNHLRGYSQRKRKALQDGAT-------- 1072

  Fly   878 LKRHLKSAHSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSGQKPHQ--CPHCDF--------Q 932
                              ..|.|...|||.....:..||.|:.::.::  |..||.        |
Zfish  1073 ------------------LDCKQRKQRARPWSKKKAFSLMHNPEEIYRLTCRFCDLVFQGPLSVQ 1119

  Fly   933 CSTIDNLRKHIIKTG-KHPGMFIYHCAKCSDEEAGEIFKSNSYKEY 977
            ...|.:|::||:.|. .|.|             ||.:..::..|:|
Zfish  1120 EDWIKHLQRHIMNTAVPHTG-------------AGMVEVTSFPKDY 1152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 4/20 (20%)
C2H2 Zn finger 731..750 CDD:275368 9/20 (45%)
C2H2 Zn finger 758..779 CDD:275368 8/21 (38%)
C2H2 Zn finger 804..824 CDD:275368 6/24 (25%)
C2H2 Zn finger 834..856 CDD:275368 6/22 (27%)
C2H2 Zn finger 898..918 CDD:275368 7/20 (35%)
zf-H2C2_2 910..935 CDD:290200 7/35 (20%)
C2H2 Zn finger 926..945 CDD:275368 8/27 (30%)
C2H2 Zn finger 957..984 CDD:275368 4/22 (18%)
znf644aNP_001265183.1 C2H2 Zn finger 349..369 CDD:275368 4/22 (18%)
C2H2 Zn finger 393..413 CDD:275368 8/20 (40%)
C2H2 Zn finger 422..439 CDD:275368 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.