Sequence 1: | NP_001036375.2 | Gene: | step / 35425 | FlyBaseID: | FBgn0086779 | Length: | 727 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024304124.1 | Gene: | PLEKHA7 / 144100 | HGNCID: | 27049 | Length: | 1365 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 56/236 - (23%) |
---|---|---|---|
Similarity: | 85/236 - (36%) | Gaps: | 84/236 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 554 INNG----GDLPRGLLESLYE---------SIRTEPFKIP--------------QDDGNDLM--- 588
Fly 589 -------------------------------------HTFFNPDK------------EGWLWKQ- 603
Fly 604 GGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREI--HDR-SKPHCFELFATGGAD 665
Fly 666 IIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQS 706 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
step | NP_001036375.2 | Sec7 | 397..577 | CDD:279680 | 10/35 (29%) |
PH_GRP1-like | 592..710 | CDD:269954 | 39/131 (30%) | ||
PH | 596..708 | CDD:278594 | 38/127 (30%) | ||
PLEKHA7 | XP_024304124.1 | WW | 11..40 | CDD:306827 | |
WW | 56..85 | CDD:306827 | 8/28 (29%) | ||
PH_PEPP1_2_3 | 159..281 | CDD:270068 | 38/123 (31%) | ||
NESP55 | <299..460 | CDD:115071 | |||
DUF1640 | 779..905 | CDD:311647 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |