DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and PLEKHA7

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_024304124.1 Gene:PLEKHA7 / 144100 HGNCID:27049 Length:1365 Species:Homo sapiens


Alignment Length:236 Identity:56/236 - (23%)
Similarity:85/236 - (36%) Gaps:84/236 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 INNG----GDLPRGLLESLYE---------SIRTEPFKIP--------------QDDGNDLM--- 588
            :|:|    .|||||..|...|         :.:|..|:.|              |::.|..|   
Human    46 VNSGHMIRSDLPRGWEEGFTEEGASYFIDHNQQTTAFRHPVTGQFSPENSEFILQEEPNPHMSKQ 110

  Fly   589 -------------------------------------HTFFNPDK------------EGWLWKQ- 603
                                                 |:|...|:            .|||.|| 
Human   111 DRNQRPSSMVSETSTAGTASTLEAKPGPKIIKSSSKVHSFGKRDQAIRRNPNVPVVVRGWLHKQD 175

  Fly   604 GGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREI--HDR-SKPHCFELFATGGAD 665
            ....:.||||||:|.|.||:|::.:.::...|.|||.:..:..:  .|| |:.:.|:...||...
Human   176 SSGMRLWKRRWFVLADYCLFYYKDSREEAVLGSIPLPSYVISPVAPEDRISRKYSFKAVHTGMRA 240

  Fly   666 IIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQS 706
            :|....|........|..|.| .||.|:||...|::.:.|:
Human   241 LIYNSSTAGSQAEQSGMRTYY-FSADTQEDMNAWVRAMNQA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 10/35 (29%)
PH_GRP1-like 592..710 CDD:269954 39/131 (30%)
PH 596..708 CDD:278594 38/127 (30%)
PLEKHA7XP_024304124.1 WW 11..40 CDD:306827
WW 56..85 CDD:306827 8/28 (29%)
PH_PEPP1_2_3 159..281 CDD:270068 38/123 (31%)
NESP55 <299..460 CDD:115071
DUF1640 779..905 CDD:311647
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.