DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and Plekha1

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_006507203.1 Gene:Plekha1 / 101476 MGIID:2442213 Length:406 Species:Mus musculus


Alignment Length:314 Identity:63/314 - (20%)
Similarity:118/314 - (37%) Gaps:99/314 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 EKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSF----RLPGEAQKIDRMMETFAQRY---CQL 508
            |:|:.:...|:.:        .||......|:|..    .||..:.::..:..|:..:.   .:|
Mouse    17 EENENSGKFLRRY--------FILDTREDSFVWYMDNPQNLPSGSSRVGAIKLTYISKVSDATKL 73

  Fly   509 NPDIFTNTDTCYVLSFAI----IMLN--------TSLHNPSVK--------DKPTVDQFISMNRG 553
            .|    ..:.|:|::..:    :..|        .::.|.::|        .:|..|       .
Mouse    74 RP----KAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKAIKITVPKQSDSQPASD-------S 127

  Fly   554 INNGGDLPRGLLESLYESIRTEPFKIPQD-----------DGNDLMHT-----FFNPD------- 595
            ::..||..:..:....:.:...|...|..           |.|:|..:     :|.|.       
Mouse   128 LSRQGDCGKKQVSYRTDIVGGVPIITPTQKEEVNECGESLDRNNLKRSQSHLPYFAPKPPSDSAV 192

  Fly   596 -KEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELF 659
             |.|:..|||...|:||||:|.|::|.:.||:...:|||..:|||     :|:|.          
Mouse   193 IKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPL-----KEVHK---------- 242

  Fly   660 ATGGADIIKACK------TDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSI 707
                   ::.||      .|:..::|....|.| :.|.:.|:...|||.::.:|
Mouse   243 -------VQECKQSDIMMRDNLFEIVTTSRTFY-VQADSPEEMHSWIKAVSGAI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 21/152 (14%)
PH_GRP1-like 592..710 CDD:269954 37/130 (28%)
PH 596..708 CDD:278594 35/118 (30%)
Plekha1XP_006507203.1 PH1_TAPP1_2 1..117 CDD:270089 17/111 (15%)
PH2_TAPP1_2 185..296 CDD:270090 35/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.