DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment step and lck

DIOPT Version :9

Sequence 1:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster
Sequence 2:XP_012812855.2 Gene:lck / 100497656 XenbaseID:XB-GENE-6054021 Length:503 Species:Xenopus tropicalis


Alignment Length:267 Identity:52/267 - (19%)
Similarity:85/267 - (31%) Gaps:114/267 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 NLCESCRMLLDRNYINT--EQSDNLVI---LRRPSKQIKDELCEVVSEMEALDVPEDCKHSNKDK 397
            ::|:.|.:...::.:.|  :..|.||.   |..||..:.|.|...:...|.:        .::|.
 Frog    18 DVCDHCHLPRQKSELITCYDIQDPLVSYTGLNPPSSPLHDNLVVALYNYEPM--------HDEDL 74

  Fly   398 QMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKA 462
            ....|.|...::.|.  |:                  :|.:.|....:| |:    .:|      
 Frog    75 GFEAGEKLHVLEQKD--EW------------------WKAKSLRTGQVG-YI----PYN------ 108

  Fly   463 FVALHDFTNLILVQALRQFLWSFR------------LPGEAQK--IDRMMETFAQRYCQLNPDIF 513
            |||        .|..:...:|.||            .||..|.  :.|..||             
 Frog   109 FVA--------SVNGIESEMWFFRDLGRKDAERQLLAPGNQQGSFLVRESET------------- 152

  Fly   514 TNTDTCYVLSFAIIMLNTSLHNPSVKDKPTVDQFISMNRG----------INNGGDL--PRGLLE 566
              |...|.|              ||:|   :||    |:|          ::|||..  ||...:
 Frog   153 --TKGSYSL--------------SVRD---LDQ----NQGEVVKHYKIRNLDNGGFYISPRKTFQ 194

  Fly   567 SLYESIR 573
            :|.|.::
 Frog   195 TLQELVQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stepNP_001036375.2 Sec7 397..577 CDD:279680 39/203 (19%)
PH_GRP1-like 592..710 CDD:269954
PH 596..708 CDD:278594
lckXP_012812855.2 SH3_Lck 59..112 CDD:212938 15/99 (15%)
SH2_Src_family 117..217 CDD:199827 26/121 (21%)
PTKc_Lck_Blk 231..494 CDD:270652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.