DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8671 and Fam102a

Sequence 1:NP_001286124.1 Gene:CG8671 FlyBaseID:FBgn0032938 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_705788.1 Gene:Fam102a MGIID:2138935 Length:392 Species:Mus musculus

Alignment Length:354 Identity:139/355 (39%)
Similarity:175/355 (49%) Gaps:94/355 (26%)


  Fly    11 MAFMMKKKKYKFNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEF 75
            |||:|||||:||.....|::|..|..||.|||.|:||||||.|...||||||:.:.|.|.:.|.|
Mouse     1 MAFLMKKKKFKFQTTFTLEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWRKRFTF 65

  Fly    76 PCKMSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTSRRFLLEGYDSRH- 139
            .||||||.:||:||||..|:|:|||:|||::|.||||.|||||||||:|.|.|..||||||::: 
Mouse    66 VCKMSANPATGLLDPCIFRVSVRKELKGGKAYSKLGFTDLNLAEFAGSGSTVRCCLLEGYDTKNT 130

  Fly   140 RLDNSMLRVSIKMHMLSGDILFKAPTPNLKSKQSKPSIDDFSNAATGVGLQIPTATALPSIGGGS 204
            |.|||:|:|:|.|.:||||..||.|....||                  :.||         |..
Mouse   131 RQDNSILKVTIGMFLLSGDPCFKTPPSTAKS------------------ISIP---------GQD 168

  Fly   205 GGASVSLGGSGVTLGGIPGNQSLPGTRPVSTTKEEDIDNQALIAAIVTDSGLSESSESGVTLTTD 269
            ....::..|.|.:.||.....||.|:||..|            ...:..|||.|..:..::    
Mouse   169 SSLQLTCKGGGTSSGGSSSTNSLTGSRPPKT------------RPTILGSGLPEEPDQSLS---- 217

  Fly   270 NLQQHGSVVVANPISPVTQALPQLGIIGSNNYGTTGGAIGFTGAGNATLIEMGHSRNSSNTSQMS 334
                          ||                              ..:...|||||||..||.|
Mouse   218 --------------SP------------------------------EEVFHSGHSRNSSYASQQS 238

  Fly   335 KGSGYSSFSHSQHSRQSSEGDSGHASRQN 363
            |.||||    ::|||.||..|..|  |:|
Mouse   239 KLSGYS----TEHSRSSSLSDLTH--RRN 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8671NP_001286124.1 NT-C2 22..161 CDD:287345 82/140 (59%)
Fam102aNP_705788.1 NT-C2 12..152 CDD:287345 82/140 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114146070
eggNOG 1 0.900 E1_28JCR
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3286
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001729
OrthoInspector 1 1.000 T616620
orthoMCL 1 0.900 OOG5_134403
Panther 1 1.100 LDO PTHR21456
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3220
TreeFam 1 0.960
1110.880

Return to query results.
Submit another query.