DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8671 and Fam102a

Sequence 1:NP_001286124.1 Gene:CG8671 FlyBaseID:FBgn0032938 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_001080009.2 Gene:Fam102a RGDID:1597535 Length:392 Species:Rattus norvegicus

Alignment Length:378 Identity:141/379 (37%)
Similarity:180/379 (47%) Gaps:110/379 (29%)


  Fly    11 MAFMMKKKKYKFNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEF 75
            |||:|||||:||.....|::|..|..||.|||.|:||||||.|...||||||:.:.|.|.:.|.|
  Rat     1 MAFLMKKKKFKFQTTFTLEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWRKRFTF 65

  Fly    76 PCKMSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTSRRFLLEGYDSRH- 139
            .||||||.:||:||||..|:|:|||:|||::|.||||.|||||||||:|.|.|..||||||::: 
  Rat    66 VCKMSANPATGLLDPCIFRVSVRKELKGGKAYSKLGFADLNLAEFAGSGSTVRCCLLEGYDTKNT 130

  Fly   140 RLDNSMLRVSIKMHMLSGDILFKAPTPNLKSKQSKPSIDDFSNAATGVGLQIPTATALPSIGGGS 204
            |.|||:|:|:|.|.:||||..||.|....||                  :.||         |..
  Rat   131 RQDNSILKVTIGMFLLSGDPCFKTPPSTAKS------------------ISIP---------GQD 168

  Fly   205 GGASVSLGGSGVTLGGIPGNQSLPGTRPVSTTKEEDIDNQALIAAIVTDSGLSESSESGVTLTTD 269
            ....::..|.|.:.||.....||.|:||...            ...:..|||:|..|..::    
  Rat   169 SSLQLTCKGGGTSSGGSSSTNSLTGSRPPKA------------RPTILGSGLAEEPEQSLS---- 217

  Fly   270 NLQQHGSVVVANPISPVTQALPQLGIIGSNNYGTTGGAIGFTGAGNATLIEMGHSRNSSNTSQMS 334
                          ||                              ..:...|||||||..||.|
  Rat   218 --------------SP------------------------------EEVFHSGHSRNSSYASQQS 238

  Fly   335 KGSGYSSFSHSQHSRQSSEGDSGHASRQN----------------GQKGDEHQ 371
            |.||:|    ::|||.||..|..|  |:|                |.:|.|.:
  Rat   239 KLSGHS----TEHSRSSSLSDLTH--RRNTSTSSSASGGLSMTVEGPEGSERE 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8671NP_001286124.1 NT-C2 22..161 CDD:287345 82/140 (59%)
Fam102aXP_001080009.2 NT-C2 12..152 CDD:287345 82/140 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114146382
eggNOG 1 0.900 E1_28JCR
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I3031
OMA 1 1.010
OrthoDB 1 1.010 D318637at33208
OrthoFinder 1 1.000 FOG0001729
OrthoInspector 1 1.000 T618741
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21456
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.