DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8671 and fam102bb

Sequence 1:NP_001286124.1 Gene:CG8671 FlyBaseID:FBgn0032938 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001038309.1 Gene:fam102bb ZFINID:ZDB-GENE-041014-330 Length:367 Species:Danio rerio

Alignment Length:356 Identity:137/357 (38%)
Similarity:168/357 (47%) Gaps:118/357 (33%)


  Fly    14 MMKKKKYKFNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEFPCK 78
            ||||||:||.|:.:|.:|..|..||.|||.|:|||||| |.|.||||.|:.:.|.|.:.|.||||
Zfish     1 MMKKKKFKFRVDFELDELSSVPFVNGVLFCKVRLLDGG-FSEESSRETVQANCVHWRKRFSFPCK 64

  Fly    79 MSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTSRRFLLEGYDSRH-RLD 142
            |||||.|||||||..|:|:|||:|||::|.||||.|||||||||:|.|:||.||||||::: |.|
Zfish    65 MSANAGTGVLDPCVCRVSVRKELKGGKTYAKLGFADLNLAEFAGSGSTTRRCLLEGYDTKNTRQD 129

  Fly   143 NSMLRVSIKMHMLSGDILFKAPTPNLKSKQSKPSIDDFSNAATGVGLQIPTATALPSIGGGSGGA 207
            ||:|:|.|...::|||..||.|          ||      .||.:|:|          |...|..
Zfish   130 NSILKVIISTQLMSGDPCFKTP----------PS------TATVIGIQ----------GDPEGLL 168

  Fly   208 SVSLGGSGVTLGGIPGNQSLPGTRPVSTTKEEDIDNQALIAAIVTDSGLSESSESGVTLTTDNLQ 272
            ....||                            |.|....::...||...|             
Zfish   169 EDRKGG----------------------------DTQKPFLSLSETSGKCSS------------- 192

  Fly   273 QHGSVVVANPISPVTQALP-QLGIIGSNNYGTTGGAIGFTGAGNATLIEMGHSRNSSNTSQMSKG 336
                             || :||:                         .||||.||..||.||.
Zfish   193 -----------------LPDELGL-------------------------CGHSRTSSYASQQSKV 215

  Fly   337 SGYSSFSHSQHSRQSSEGDSGHASRQNGQKG 367
            ||||    :.|||.||..:..|  |:|...|
Zfish   216 SGYS----TSHSRSSSLSEFSH--RRNTSIG 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8671NP_001286124.1 NT-C2 22..161 CDD:287345 85/140 (61%)
fam102bbNP_001038309.1 NT-C2 10..148 CDD:287345 84/139 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114140230
eggNOG 1 0.900 E1_28JCR
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 266 1.000 Inparanoid score I2970
OMA 1 1.010
OrthoDB 1 1.010 D318637at33208
OrthoFinder 1 1.000 FOG0001729
OrthoInspector 1 1.000 T597493
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21456
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3220
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.990

Return to query results.
Submit another query.