DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cad and cdx1a

Sequence 1:NP_001260641.1 Gene:cad FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_998001.2 Gene:cdx1a ZFINID:ZDB-GENE-050510-1 Length:228 Species:Danio rerio

Alignment Length:240 Identity:88/241 (37%)
Similarity:99/241 (41%) Gaps:102/241 (42%)


  Fly   128 SGGAPG---APQLNETNSSIGVGGAGGGGGVGGATDGGPGSA---PPNHQQHIAEGLPSPPITVS 186
            ||..||   ...|:.|.||...|             .||||.   ||.:.......||:     :
Zfish    38 SGYHPGPALGNDLHHTGSSWSPG-------------FGPGSRDDWPPLYGHGTGHSLPA-----N 84

  Fly   187 GSEIS---------SPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNN 242
            |.|:|         ..|||.....|.                                       
Zfish    85 GVEVSVLPSVDQGLLSGAPVDREEPQ--------------------------------------- 110

  Fly   243 NRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELE 307
                       |||::.|.|..|                   .|||||||||||||:|.||||||
Zfish   111 -----------DWMRRSAVPTNP-------------------GGKTRTKDKYRVVYSDVQRLELE 145

  Fly   308 KEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK 352
            ||:..|||||||||:|||.||:|||||||||||||||||||.|||
Zfish   146 KEFHFSRYITIRRKAELAGTLNLSERQVKIWFQNRRAKERKMNKK 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 44/52 (85%)
cdx1aNP_998001.2 Caudal_act 11..115 CDD:282574 27/145 (19%)
COG5576 <122..227 CDD:227863 59/89 (66%)
Homeobox 133..185 CDD:278475 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230791101
eggNOG 1 0.900 E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001156
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.