DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fs(2)Ket and Apl

Sequence 1:NP_001246108.1 Gene:Fs(2)Ket FlyBaseID:FBgn0262743 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_730182.1 Gene:Apl FlyBaseID:FBgn0042178 Length:1080 Species:Drosophila melanogaster

Alignment Length:889 Identity:169/890 (19%)
Similarity:300/890 (34%) Gaps:263/890 (30%)


  Fly    40 PEFLKALSEILVNTANSAVARMAAGLQLKNHLTSKDEKVSQQYQDRWHQFPSEIRELIKNNILAA 104
            |:.|..|::|:::. .....|..|.:.||..:    :|:.     .|...|:|.:..||:|:|..
  Fly    34 PDSLLVLTQIVMSD-RPVQERQVAAVLLKRRV----KKLR-----HWQLVPAEHQAAIKSNMLQV 88

  Fly   105 LGTENTRPSCAAQCVAYVAVIELPI-NRWPMLIQTLVNKVVSEGSSEMHRESALEAIGYIC---- 164
            |                :||.|..: .....:|.:||..  .||.....||..|:.|...|    
  Fly    89 L----------------IAVKEKTVKGTVAFIIGSLVRH--EEGEQNSWREEILKFIYERCSSPD 135

  Fly   165 -------QDIRFGVME------NQSNDVLTAIIHGMRKVEPSNHVRLAATTALHNSLEFTKSNFE 216
                   ..|...:|:      :...|.:..::.|:.....:|  ...||..:||.|  |.|   
  Fly   136 PIESERGSSIFSSLMDAAPDQFSDHTDTMFPLLAGILVTAEAN--GNMATPTVHNML--TGS--- 193

  Fly   217 KDMERNFIMEVVCEATQCQDSQICVAALQCLVKIMTLYYQYMEPYMAQALFPITLAAMKSDNDAV 281
                 .|::..|...:..:  ||.|.|:..::|.:..:.:  :.|..:.:....:....:::...
  Fly   194 -----CFLLPFVSGHSNAE--QIVVKAVPLILKALAAFVE--KGYSIEFMGAFDIIDSMAEHVPH 249

  Fly   282 ALQG-----IEFWSNVC-DEEIDLAIESQEATDQGRAPQRVSKHYARGALQFLTP---VLVEKLT 337
            .|.|     :||...:. :::.|.:|..|..|..|...:...|...:..|  |.|   ||.|.:.
  Fly   250 LLTGNVKLLLEFCLMIARNKQFDASIRVQVLTFVGSLVRLKKKIIMKQKL--LQPTLSVLFEVIC 312

  Fly   338 KQD--ECDD-----EDTWSPAKAASVCLMVLAT-CCEDEIVPHVLPFIKENIESPNWRFRDAAVM 394
            :.|  |.||     |...||:.||:..|.::|. ...|:.:|.:|..::..::||....|.::.:
  Fly   313 QDDLEEGDDDYFSSESLSSPSNAAAQTLDLMALHMVPDKFIPPLLDLLEPALQSPEPVLRRSSFI 377

  Fly   395 TFGSVLNGLETNTLKPLVEQAMPTLIRLMYDSSVIVRDTIAWTFGR--------ICDIIPEAAIN 451
            ..|.:..|......|..:|..:..:...:.||.:.||....:..|:        ||...|:    
  Fly   378 CMGVIAEGCSEAIGKKYLEVMLNIIKAGVLDSVMFVRTAAFFALGQFSEFLQPTICKFAPQ---- 438

  Fly   452 ETYLQTLLECFVKSLKSEPRVAANVCWAFIGLSDAAWEAAVTNDGETPETYALSPYFEYIITQLL 516
              .|..|.: ::..|..|.:|                       || |::..:...| |.:....
  Fly   439 --ILPVLFD-YLNQLVLELKV-----------------------GE-PDSKHMDRMF-YALETFC 475

  Fly   517 ETTDRSDGAQANLRCAAYQALMDMIKNSPLDCYLVVQRTTLVILERLNQVMQMETQINNHSDRHQ 581
            |..|.                 |::...|            .:::||..||:.:..         
  Fly   476 ENLDE-----------------DIVPYLP------------TLMDRLFGVMEPQNS--------- 502

  Fly   582 FNDLQSLLCATLQSVLRKVHEQDAPQISDAIMTALLTMFNSSAGKSGVVQEEAFLAVSTLVELLG 646
             |.::.:..:.:.:|.....|...|.. ..|||.|.........|.  :..:...|:.||..|  
  Fly   503 -NQMREMALSAIAAVSAAAKENLMPYF-PRIMTVLQGCLVKDCPKE--MYSQRIQAIDTLAAL-- 561

  Fly   647 AQFAKYMPAFKDFLVMGLKNFQEYQVCCAAVGLTGDIFRALKDLMVPYSNEIMT----VLINNLT 707
                                       |..:|         ||.::|.:::.|.    :|.:...
  Fly   562 ---------------------------CRELG---------KDNIIPLADDTMNFCLMMLEDGPD 590

  Fly   708 EPTIHRTVKPQVLSAFGDIALSIGNHFLPYLSMVL-------DML-RVASNLQTDANNFDM---- 760
            :|...|::...:.|....:..|:.:.|..::..::       ||: .|:.|...|....|.    
  Fly   591 DPEYRRSIYNLMSSLSSVVNESMASVFPKFIDRIMESVIFSEDMVPNVSDNADDDLALVDAPDIE 655

  Fly   761 ------------------NEYINELRESILE-----AYTGIIQGLKGVDQTAHTDVMHMEPHLMH 802
                              |:||.|..|:||.     .:||  .......|:|..:|..|..|   
  Fly   656 IDLEHTDDEDDQDAYPVENDYIVEKEEAILSLKEFATHTG--AAFAPYLQSAFENVYKMIDH--- 715

  Fly   803 IISFIKRIAQEGDVSDSMLASAAGFIGDLCTSFGPRLYPLLDDA 846
                     .:|||..:.:.|...||..|         ..||||
  Fly   716 ---------PQGDVRMACIDSICSFITAL---------HKLDDA 741

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fs(2)KetNP_001246108.1 KAP95 17..876 CDD:227540 169/890 (19%)
IBN_N 27..107 CDD:281761 17/67 (25%)
HEAT repeat 136..162 CDD:293787 9/26 (35%)
HEAT repeat 179..209 CDD:293787 7/30 (23%)
HEAT repeat 223..255 CDD:293787 7/32 (22%)
HEAT repeat 264..291 CDD:293787 4/32 (13%)
HEAT repeat 330..360 CDD:293787 14/40 (35%)
HEAT repeat 373..401 CDD:293787 5/28 (18%)
HEAT_EZ 386..441 CDD:290247 10/63 (16%)
HEAT repeat 414..444 CDD:293787 7/38 (18%)
HEAT repeat 457..482 CDD:293787 4/25 (16%)
HEAT repeat 508..540 CDD:293787 5/32 (16%)
AplNP_730182.1 IBN_N 29..90 CDD:197981 17/82 (21%)
HEAT repeat 356..384 CDD:293787 5/28 (18%)
HEAT repeat 397..427 CDD:293787 5/30 (17%)
HEAT repeat 438..473 CDD:293787 10/67 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105283897
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10527
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.