DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2617 and LUL1

DIOPT Version :10

Sequence 1:NP_610050.1 Gene:CG2617 / 35331 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_195940.1 Gene:LUL1 / 831908 AraportID:AT5G03200 Length:337 Species:Arabidopsis thaliana


Alignment Length:100 Identity:31/100 - (31%)
Similarity:53/100 - (53%) Gaps:7/100 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LIYLLQRGRIEISTKTQSVYLWTHHKLQHFIHNVWYVSENA--GSASPERCVVCMAQSRNVVVMP 237
            ::|..::|.|:|....|  .||.:.:....:.  .|..||.  ||...:.||||:::.|:..|:|
plant   239 VVYTKEKGEIKIEVVKQ--ILWVNKRRYELLE--IYGIENTVDGSDEGKECVVCLSEPRDTTVLP 299

  Fly   238 CRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSV 272
            |||:|:|..|: :.:....:.|||||..:...|.:
plant   300 CRHMCMCSGCA-KALRFQTNLCPVCRQPVEMLLEI 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2617NP_610050.1 zf-C3HC4_3 223..269 CDD:464042 18/45 (40%)
LUL1NP_195940.1 Atrophin-1 <17..>103 CDD:460830
mRING-HC-C3HC5_MGRN1-like 283..324 CDD:438443 16/41 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.