DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2617 and LUL2

Sequence 1:NP_001260636.1 Gene:CG2617 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_190909.1 Gene:LUL2 AraportID:AT3G53410 Length:299 Species:Arabidopsis thaliana

Alignment Length:96 Identity:28/97 (29%)
Similarity:51/97 (53%) Gaps:8/97 (8%)


  Fly   185 EISTKTQSVYLWTH---HKLQHFIHNVWYVSENAGSASPER---CVVCMAQSRNVVVMPCRHLCL 243
            |...:.....||.:   :.||. |:.:....::.|..:.||   ||:|:::.|:..|:||||:|:
plant   200 EYKARVVKQILWVNGNRYVLQE-IYGIGNTVDDNGEDANERGKECVICLSEPRDTTVLPCRHMCM 263

  Fly   244 CKECSLQLVLLLEDRCPVCRHNITSFLSVYV 274
            |..|: :|:....:.||:||..:...|.:.|
plant   264 CSGCA-KLLRFQTNLCPICRQPVDRLLEITV 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 17/46 (37%)
LUL2NP_190909.1 zf-C3HC4_3 241..288 CDD:290631 17/48 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22996
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.