DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2617 and LUL2

DIOPT Version :10

Sequence 1:NP_610050.1 Gene:CG2617 / 35331 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_190909.1 Gene:LUL2 / 824509 AraportID:AT3G53410 Length:299 Species:Arabidopsis thaliana


Alignment Length:96 Identity:28/96 - (29%)
Similarity:51/96 - (53%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 EISTKTQSVYLWTH---HKLQHFIHNVWYVSENAGSASPER---CVVCMAQSRNVVVMPCRHLCL 243
            |...:.....||.:   :.||. |:.:....::.|..:.||   ||:|:::.|:..|:||||:|:
plant   200 EYKARVVKQILWVNGNRYVLQE-IYGIGNTVDDNGEDANERGKECVICLSEPRDTTVLPCRHMCM 263

  Fly   244 CKECSLQLVLLLEDRCPVCRHNITSFLSVYV 274
            |..|: :|:....:.||:||..:...|.:.|
plant   264 CSGCA-KLLRFQTNLCPICRQPVDRLLEITV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2617NP_610050.1 zf-C3HC4_3 223..269 CDD:464042 17/45 (38%)
LUL2NP_190909.1 mRING-HC-C3HC5_MGRN1-like 241..282 CDD:438443 15/41 (37%)

Return to query results.
Submit another query.