DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2617 and mgrn1a

DIOPT Version :9

Sequence 1:NP_001260636.1 Gene:CG2617 / 35331 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001315473.1 Gene:mgrn1a / 793939 ZFINID:ZDB-GENE-030131-6192 Length:554 Species:Danio rerio


Alignment Length:147 Identity:33/147 - (22%)
Similarity:62/147 - (42%) Gaps:32/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VVHSIVAHGLSLLNSAFRASIGLALLLVLYMFRRYVYLMLIYLLQRGRIEISTKTQSVYLWTHHK 200
            ||.:||..|..:...|.         ::|..|.|:|         .|...:....|...:   .:
Zfish   200 VVQAIVDDGDDVTGHAH---------VLLAAFERHV---------DGSFSVKPLKQKQIV---DR 243

  Fly   201 LQHFIHNVWYV----------SENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLL 255
            :.:.:..::.:          :|:..|.:...||||::..|:.:::||||||||..|: ..:...
Zfish   244 VSYLLQEIYGIENRNNQETKSTEDENSDNSSECVVCLSDLRDTLILPCRHLCLCNACA-DTLRYQ 307

  Fly   256 EDRCPVCRHNITSFLSV 272
            .:.||:||....:.|.:
Zfish   308 ANNCPICRLPFRALLQI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 18/45 (40%)
mgrn1aNP_001315473.1 PHA02929 <230..329 CDD:222944 22/99 (22%)
zf-C3HC4_3 275..317 CDD:290631 18/42 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22996
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.