DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2617 and rnf26

Sequence 1:NP_001260636.1 Gene:CG2617 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_005157651.1 Gene:rnf26 ZFINID:ZDB-GENE-060727-1 Length:427 Species:Danio rerio

Alignment Length:351 Identity:71/352 (20%)
Similarity:135/352 (38%) Gaps:112/352 (32%)


  Fly     5 LIRAAELV--DLV----LLRPLASVIDAVITGVYYFLWGSYLVGFCLVEGSRKGWNLLRCAVRNI 63
            |:|..||:  .|:    |||........:.:.:.||:  :.:|...|: |::..::||...|..:
Zfish   108 LLRTKELLHRGLLSGHGLLRQAWEGFGILFSLLLYFI--NTIVNLLLI-GTQNLYSLLVSTVEAV 169

  Fly    64 NEGIRDLGLITLDVADYFYGGTKGGLKNVLDFGHC--ISRFI---CNLLIDL----GDGILWLLM 119
            :..::....:.|.|..:.|....|  .::|.:..|  ...|:   |::.:.:    ..|:|..|:
Zfish   170 SCPLQKALELALTVLTFLYSSLVG--TSILLWTPCRLAMEFLGSACHIFVSIFLLNSYGLLLTLV 232

  Fly   120 LLPRAILFLWDCLLDFVVHSIVAHGLSLLNSAFRASIGLALL----LVLYMFRRYVYLMLIYLLQ 180
            ::..|.::                    ||.|....:.|.::    .|..:.|..:.|..:|:|:
Zfish   233 IITGATVY--------------------LNPALPRQVSLRMITYVNTVPILRRLQMVLQRLYVLE 277

  Fly   181 RG-------------------------------RIEISTKTQSV---------------YLWTHH 199
            |.                               ::|::...|.|               ....|.
Zfish   278 RNVWQRLAWHRSRIGLLVAAERDIGQAEPNIEPQVELNVPNQEVEDVPEDAPQPDIPLPSSSAHR 342

  Fly   200 KLQHFIHNVWYVSENAGSASP--------------ERCVVCMAQSRNVVVMPCRHLCLCKECSLQ 250
            .|:.|      .||::....|              ::||:|...::.||::||||||||:||:..
Zfish   343 PLRKF------PSEDSCRGPPTDNLLNLLQEQEERKKCVICQDSTKTVVLLPCRHLCLCRECTNI 401

  Fly   251 LVL--LLEDRCPVCRHNITSFLSVYV 274
            |:.  :.:..||:|||.|...:.||:
Zfish   402 LLRQPMYQQNCPLCRHMILQTMDVYL 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 22/48 (46%)
rnf26XP_005157651.1 zf-C3HC4_3 370..422 CDD:290631 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005554
OrthoInspector 1 1.000 T1053490
orthoMCL 1 0.900 OOG5_141438
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9347
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.