| Sequence 1: | NP_001260636.1 | Gene: | CG2617 / 35331 | FlyBaseID: | FBgn0032877 | Length: | 274 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_114404.1 | Gene: | RNF26 / 79102 | HGNCID: | 14646 | Length: | 433 | Species: | Homo sapiens |
| Alignment Length: | 436 | Identity: | 89/436 - (20%) |
|---|---|---|---|
| Similarity: | 146/436 - (33%) | Gaps: | 178/436 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MLDALIRAAELVDLVLLRPLASVI----------DAVITGVYYFLWGSYLVGFCLVEGSRKGWNL 55
Fly 56 LRCAVRNINEGIRDL---------GLITLDVADYF--YGGTKG------GLKNVLDFGHCISR-- 101
Fly 102 ------------FICNLLID---LGDGILWLLMLLPRAILFLWDCL------LDFVVHSIVAH-- 143
Fly 144 ----------------GLSLLNSAFR--ASIGLALLLVLYMFRRYVYLMLIYLLQRGRIEISTK- 189
Fly 190 -TQSVYLWTHHKLQHFI-------------HNVWYVS------ENAGSAS--------------- 219
Fly 220 ------PE------------------------------------------------RCVVCMAQS 230
Fly 231 RNVVVMPCRHLCLCKECSLQLVL--LLEDRCPVCRHNITSFLSVYV 274 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2617 | NP_001260636.1 | zf-C3HC4_3 | 223..269 | CDD:290631 | 21/47 (45%) |
| RNF26 | NP_114404.1 | mRING-HC-C3HC5_RNF26 | 378..425 | CDD:319702 | 20/46 (43%) |
| modified RING-HC finger (C3HC5-type) | 380..421 | CDD:319702 | 18/40 (45%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4265 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S7529 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0006367 | |
| OrthoInspector | 1 | 1.000 | - | - | oto91364 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_113023 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R9347 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.780 | |||||