DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2617 and cgrrf1

Sequence 1:NP_001260636.1 Gene:CG2617 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001038722.1 Gene:cgrrf1 ZFINID:ZDB-GENE-040724-100 Length:337 Species:Danio rerio

Alignment Length:115 Identity:29/116 (25%)
Similarity:45/116 (39%) Gaps:39/116 (34%)


  Fly   183 RIEISTKTQSVYLWTHHKLQHFIHNVWYVSEN---AGSASPER---------------------- 222
            :..:||:....||.|.|...:.:..::..::|   :||:.|.|                      
Zfish   202 KYRLSTRILFQYLLTAHGTLYDLKPLFMSADNSNLSGSSEPSRTQGAELQPESSGEKGEESDSEG 266

  Fly   223 ---------CVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCR 263
                     ||||...|.|.|::||||.|:|..|..:.     ..||:||
Zfish   267 EWPDIQGRDCVVCQNASINRVLLPCRHACVCDGCVCRF-----QHCPICR 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 18/42 (43%)
cgrrf1NP_001038722.1 zf-C3HC4_3 276..314 CDD:290631 18/42 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.