DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2617 and Rnf157

Sequence 1:NP_001260636.1 Gene:CG2617 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_017453233.1 Gene:Rnf157 RGDID:1591154 Length:685 Species:Rattus norvegicus

Alignment Length:146 Identity:36/147 (24%)
Similarity:59/147 (40%) Gaps:25/147 (17%)


  Fly   136 VVHSIV-------AHGLSLLNSAFRASIGLALLLVLYMFRRYVYLMLIYLLQRG-RIEISTKTQS 192
            |||::|       .|...||.:..:.|.|...:..|...:...:..:.||||.. .||..:.||.
  Rat   200 VVHAVVDEGDEYFGHCHVLLGTFEKHSDGTFCVKPLKQKQVVRWDGVTYLLQEDYGIENKSNTQD 264

  Fly   193 VYLWTHHKLQHFIHNVWYVSENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLE- 256
            .                .|:|:....:...||||::..|:.:::||||...|........|..: 
  Rat   265 S----------------RVAEDDVRDNSAECVVCLSDVRDTLILPCRHCASCNHLHCADTLRYQA 313

  Fly   257 DRCPVCRHNITSFLSV 272
            :.||:||....:.|.:
  Rat   314 NNCPICRLPFRALLQI 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 15/47 (32%)
Rnf157XP_017453233.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22996
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.