DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2617 and mgrn1b

DIOPT Version :10

Sequence 1:NP_610050.1 Gene:CG2617 / 35331 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001138254.1 Gene:mgrn1b / 553327 ZFINID:ZDB-GENE-110401-3 Length:549 Species:Danio rerio


Alignment Length:61 Identity:21/61 - (34%)
Similarity:36/61 - (59%) Gaps:1/61 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 SENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSV 272
            |::..|.:...||||::..|:.:::||||||||..|: ..:....:.||:||....:.|.:
Zfish   265 SDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCA-DTLRYQANNCPICRLPFRALLQI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2617NP_610050.1 zf-C3HC4_3 223..269 CDD:464042 18/45 (40%)
mgrn1bNP_001138254.1 mRING-HC-C3HC5_RNF157 270..329 CDD:438466 20/56 (36%)

Return to query results.
Submit another query.