DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2617 and mgrn1

Sequence 1:NP_001260636.1 Gene:CG2617 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001016911.1 Gene:mgrn1 XenbaseID:XB-GENE-963240 Length:508 Species:Xenopus tropicalis

Alignment Length:147 Identity:35/148 (24%)
Similarity:68/148 (46%) Gaps:24/148 (16%)


  Fly   132 LLDFVVHSIVAHG------LSLLNSAFRASIGLALLLVLYMFRRYVYLMLIYLLQRGRIEISTKT 190
            ::..|:.::||.|      ..:|.:||...:. ....|..:.::.:...:.||||    ||    
 Frog   196 IVPLVIQAVVAEGGEGSAHAHVLLAAFEKHVD-GSFSVKPLKQKQIVDRVSYLLQ----EI---- 251

  Fly   191 QSVYLWTHHKLQHFIHNVWYVSENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLL 255
                    :.:::..:.....|::..|.:...||||::..|:.:::||||||||..|: ..:...
 Frog   252 --------YGIENKNNQDTKQSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSCA-DTLRYQ 307

  Fly   256 EDRCPVCRHNITSFLSV 272
            .:.||:||....:.|.:
 Frog   308 ANNCPICRLPFRALLQI 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 18/46 (39%)
mgrn1NP_001016911.1 PHA02929 <230..329 CDD:222944 28/113 (25%)
zf-C3HC4_3 272..317 CDD:290631 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.