powered by:
Protein Alignment CG2617 and Mgrn1
DIOPT Version :9
| Sequence 1: | NP_001260636.1 |
Gene: | CG2617 / 35331 |
FlyBaseID: | FBgn0032877 |
Length: | 274 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_006245854.1 |
Gene: | Mgrn1 / 302938 |
RGDID: | 1311862 |
Length: | 578 |
Species: | Rattus norvegicus |
| Alignment Length: | 61 |
Identity: | 21/61 - (34%) |
| Similarity: | 36/61 - (59%) |
Gaps: | 1/61 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 212 SENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSV 272
|::..|.:...||||::..|:.:::||||||||..|: ..:....:.||:||....:.|.:
Rat 268 SDDENSDNSSECVVCLSDLRDTLILPCRHLCLCTSCA-DTLRYQANNCPICRLPFRALLQI 327
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4265 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR22996 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.000 |
|
Return to query results.
Submit another query.