DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2617 and Rnf26

Sequence 1:NP_001260636.1 Gene:CG2617 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001107220.1 Gene:Rnf26 RGDID:1305953 Length:424 Species:Rattus norvegicus

Alignment Length:417 Identity:90/418 (22%)
Similarity:145/418 (35%) Gaps:149/418 (36%)


  Fly     1 MLDALIRAAELVDLV---LLRPLASVI-------DAVITGVYYFLWGSYLVGFCLVE-------G 48
            |||.|....:|..|:   ||..||.::       ..|:|.:.:...|..|....|||       |
  Rat    14 MLDLLTLVLDLNFLLVSSLLATLAWLLAFIYNLPHTVLTSLLHLGRGFLLYLVALVEAVVRFTFG 78

  Fly    49 SRKGWNLLRCAVRNINEGIRDLGLITLDVADYFYGGTKG------GLKNVLDFGHCISRFICNLL 107
            ..:....|.|:..:..|.::.||.:.      .:|..|.      |:.|::..||.:.|..|::.
  Rat    79 GLQALCTLLCSCYSGLESLKLLGHLA------SHGALKSRELLNRGILNMISNGHGLLRQACDIC 137

  Fly   108 IDLGDGILWLLMLLPR-----------AILFLWDCL------LDFVVHSIVAH------------ 143
            ......:.:::..|..           .:|.|||.:      :..||...:||            
  Rat   138 AIAMSLVAYVVNSLVNICLIGTQNFFSLVLALWDAVTGPLWRMTDVVAGFLAHISSSAVAMAILL 202

  Fly   144 ------GLSLLNSAFR--ASIGLALLLVLYMFRRYVYLMLIYLLQRGRIEISTK--TQSVYLWTH 198
                  .|.||.||.|  ||..|..|..|.:....:.::||.|.....:.::|:  .|.....::
  Rat   203 WTPCQLVLELLASAVRVLASCVLFHLTGLVLLACVLVVILIALHPEQTLRLATRALNQLHARPSY 267

  Fly   199 HKLQHFI-------------HNVWYVS------ENAGSAS---------------------PE-- 221
            |:|:..:             ..||..|      .|.|.|.                     ||  
  Rat   268 HRLREDVVRLSRLPLGLEAWRRVWSRSLQLASWPNRGGAPGAPQGGPRRVFSARIQPQDPLPEAD 332

  Fly   222 -------------------------------------RCVVCMAQSRNVVVMPCRHLCLCKECSL 249
                                                 :||:|..||:.|:::||||||||:.|:.
  Rat   333 EEVIRTAAARGRERLNEEEPTAGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTE 397

  Fly   250 QLVL--LLEDRCPVCRHNITSFLSVYV 274
            .|:.  :....||:||.:|...|:||:
  Rat   398 ILMRHPVYHRNCPLCRRSILQTLNVYL 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 21/48 (44%)
Rnf26NP_001107220.1 zf-C3HC4_3 367..419 CDD:290631 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005554
OrthoInspector 1 1.000 T1087852
orthoMCL 1 0.900 OOG5_141438
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.