DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2617 and MGRN1

Sequence 1:NP_001260636.1 Gene:CG2617 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_056061.1 Gene:MGRN1 HGNCID:20254 Length:576 Species:Homo sapiens

Alignment Length:61 Identity:21/62 (34%)
Similarity:36/62 (58%) Gaps:1/62 (2%)


  Fly   212 SENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSV 272
            |::..|.:...||||::..|:.:::||||||||..|: ..:....:.||:||....:.|.:
Human   267 SDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCA-DTLRYQANNCPICRLPFRALLQI 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2617NP_001260636.1 zf-C3HC4_3 223..269 CDD:290631 18/46 (39%)
MGRN1NP_056061.1 PHA02929 <232..331 CDD:331986 21/62 (34%)
mRING-HC-C3HC5_MGRN1_like---blasttree 277..317 CDD:319703 17/41 (41%)
modified RING-HC finger (C3HC5-type) 278..316 CDD:319703 16/39 (41%)
Required for TSG101-binding 406..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22996
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.