powered by:
Protein Alignment CG2617 and RNF157
DIOPT Version :9
Sequence 1: | NP_001260636.1 |
Gene: | CG2617 / 35331 |
FlyBaseID: | FBgn0032877 |
Length: | 274 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016879606.1 |
Gene: | RNF157 / 114804 |
HGNCID: | 29402 |
Length: | 688 |
Species: | Homo sapiens |
Alignment Length: | 62 |
Identity: | 22/62 - (35%) |
Similarity: | 37/62 - (59%) |
Gaps: | 1/62 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 VSENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSV 272
|:|:..|.:...||||::..|:.:::||||||||..|: ..:....:.||:||....:.|.:
Human 265 VAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCA-DTLRYQANNCPICRLPFRALLQI 325
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2617 | NP_001260636.1 |
zf-C3HC4_3 |
223..269 |
CDD:290631 |
18/45 (40%) |
RNF157 | XP_016879606.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4265 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22996 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.