DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2617 and RNF157

DIOPT Version :10

Sequence 1:NP_610050.1 Gene:CG2617 / 35331 FlyBaseID:FBgn0032877 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001425650.1 Gene:RNF157 / 114804 HGNCID:29402 Length:680 Species:Homo sapiens


Alignment Length:62 Identity:22/62 - (35%)
Similarity:37/62 - (59%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 VSENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSV 272
            |:|:..|.:...||||::..|:.:::||||||||..|: ..:....:.||:||....:.|.:
Human   265 VAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNTCA-DTLRYQANNCPICRLPFRALLQI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2617NP_610050.1 zf-C3HC4_3 223..269 CDD:464042 18/45 (40%)
RNF157NP_001425650.1 D-box 1. /evidence=ECO:0000303|PubMed:28655764 329..332
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..362
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 651..680
D-box 2. /evidence=ECO:0000303|PubMed:28655764 657..660
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.