DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2614 and SPE4

DIOPT Version :8

Sequence 1:NP_610045.1 Gene:CG2614 / 35326 FlyBaseID:FBgn0032873 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_013247.1 Gene:SPE4 / 850838 SGDID:S000004136 Length:300 Species:Saccharomyces cerevisiae

Alignment Length:186 Identity:47/187 (25%)
Similarity:79/187 (42%) Gaps:42/187 (22%)


  Fly   439 DFGYLACQHHLYMSVGVQLATTVQHPKRDVEKDVLVVGLGGGGLCSFL--HAALPQARITAVEID 501
            :|.|.....|:.|...       .:|||     ||::|.|.||:...:  |:.:..  ||.||||
Yeast    71 EFAYQEMITHIAMFAH-------SNPKR-----VLIIGGGDGGVLREVAKHSCVED--ITMVEID 121

  Fly   502 PIMLEVAEQYFELK-----QDKRFHVVIDDGLDFVERCRNEDIH--FDAVLFDVDSKDLSLGMSC 559
            ..::|::.::....     .|:|..:.:.||..|::.....|:|  ||.::  .||.|    ...
Yeast   122 SSVIELSRKFLPTLSNGAFDDERLDLKLCDGFKFLQDIGASDVHKKFDVII--TDSSD----PEG 180

  Fly   560 PPQSFLATKILQHIKEIIGPKGL--------FMLNLVCRDESLRTEALNNLHKVFP 607
            |.::|...:..:.:|:.:.|.|:        |.|||     ....:..|...||||
Yeast   181 PAEAFFQERYFELLKDALNPNGVVIMQSSENFWLNL-----KYLHDLKNTAKKVFP 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2614NP_610045.1 AdoMet_MTases 55..157 CDD:302624
AdoMet_MTases <483..>612 CDD:302624 34/143 (24%)
SPE4NP_013247.1 speE 14..293 CDD:188048 47/187 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.