DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2614 and AT5G04610

DIOPT Version :8

Sequence 1:NP_610045.1 Gene:CG2614 / 35326 FlyBaseID:FBgn0032873 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_568139.1 Gene:AT5G04610 / 830338 AraportID:AT5G04610 Length:434 Species:Arabidopsis thaliana

Alignment Length:388 Identity:110/389 (28%)
Similarity:184/389 (47%) Gaps:62/389 (16%)


  Fly   275 PSEQTPRYTIH--ILDKP-------PARGLGKYAAFIVPQGREVEWIFSTPAGR-KKLQDSANFQ 329
            |:..:|.:.:.  :||.|       |.|    .||.:||:.||.:|||||.:|: :.|.:.....
plant    22 PNPNSPIHLLRVAVLDSPVHSTESSPPR----VAAILVPKHRESDWIFSTESGQLQLLLNMPEIS 82

  Fly   330 RLAVVTLHRD------QVY---STLDEVKQELADSIK----NLSPAGLT----DQIPYLSLGSDV 377
            ||.::....|      .||   :..|:..::|...:|    .|.|..||    |.:|:|....:|
plant    83 RLILIGDDHDTDSDLPAVYHRPNGEDDESEKLEIRLKPLVVALLPKTLTREEIDDVPFLIYDDNV 147

  Fly   378 GKRETLICGFSKISGDFRIEEVEAN-----GKTLRRLIFLSNQFVVQSEALV-------KTVKIK 430
            .....:........|:..||:||..     .:..|||.|.....:|||...:       .::.:.
plant   148 VSSVEIEKCVGPFVGEMLIEDVEIEIDDGVREFRRRLRFKRMPNLVQSAIKIIPRSCSNPSLPLM 212

  Fly   431 G---KKDRKKIDFGYLACQHHLYMSVGVQLATTVQHPKRDVEKDVLVVGLGGGGLCSFLHAALPQ 492
            |   |.|..::...|||   .:..|:.:..:....|.|.  :...|.:|:|||||.|||...| .
plant   213 GTEFKLDLTELVHPYLA---PMVASLSLIGSDVYDHLKS--KPKALCIGVGGGGLLSFLRLQL-G 271

  Fly   493 ARITAVEIDPIMLEVAEQYFELKQD-KRFHVVIDDGLDFVER----CRNEDIHFDAVLFDVDSKD 552
            ..:|.|||||.:|.:|.|||.|::. .|.||  :||::|::|    | ::|..||.::.|:||.|
plant   272 FEVTGVEIDPEVLRIARQYFGLEESLARVHV--EDGIEFLKRLSKSC-DDDARFDVLMVDLDSTD 333

  Fly   553 LSLGMSCPPQSFLATKILQHIKEIIGPKGLFMLNLVCRDESLRTEALNNLHKVFPAVCSYKLE 615
            ...||:.||..|:|..:|...:.::.|.|:|::|::..:::...|..:....||..:  |:::
plant   334 PIHGMTAPPVEFVAKDVLLAARTVLVPSGVFIINVIPPNKTFYQELQDQFRHVFAEL--YEID 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2614NP_610045.1 AdoMet_MTases 55..157 CDD:302624
AdoMet_MTases <483..>612 CDD:302624 45/134 (34%)
AT5G04610NP_568139.1 AdoMet_MTases <245..>367 CDD:302624 50/128 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D912165at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.