DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2614 and AT3G60910

DIOPT Version :8

Sequence 1:NP_610045.1 Gene:CG2614 / 35326 FlyBaseID:FBgn0032873 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_191650.2 Gene:AT3G60910 / 825262 AraportID:AT3G60910 Length:252 Species:Arabidopsis thaliana

Alignment Length:142 Identity:51/143 (36%)
Similarity:82/143 (57%) Gaps:5/143 (3%)


  Fly    16 YWNEFFKKRGEKAFEWYGEYLELCDQIHKYIKPADRILMLGCGNSKLSMDMYDTGFRDITNIDIS 80
            ||:..: .:...:|:||..|..|...:..::..:.|:||:|||||.:|.||...|:.||.|:|||
plant    18 YWDARY-VQDALSFDWYQCYSSLRPFVRSFVSTSSRVLMVGCGNSLMSEDMVKDGYEDIMNVDIS 81

  Fly    81 PIAVKKMLELNAKSRPEMKFLQMDATAMT-FPDESFSVSLDKGTLDALFADDEPETRAVVENYFK 144
            .:|: :|::....|.|::|::|||...|: |.|:||...:||||||:|....:....|  .....
plant    82 SVAI-EMMQTKYASVPQLKYMQMDVRDMSYFEDDSFDTIIDKGTLDSLMCGSDALLSA--SRMLG 143

  Fly   145 EILRTMRNGGRY 156
            |:.|.::.||.|
plant   144 EVSRLIKPGGTY 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2614NP_610045.1 AdoMet_MTases 55..157 CDD:302624 41/104 (39%)
AdoMet_MTases <483..>612 CDD:302624
AT3G60910NP_191650.2 Methyltransf_11 56..157 CDD:285453 41/104 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127173
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.