DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: phr6-4 and LOC100486741

Sequence 1:NP_001260632.1 Gene:phr6-4 FlyBaseID:FBgn0016054 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_002938187.1 Gene:LOC100486741 XenbaseID:XB-GENE-5887601 Length:862 Species:Xenopus tropicalis

Alignment Length:587 Identity:165/588 (28%)
Similarity:242/588 (41%) Gaps:127/588 (22%)


  Fly    11 WFRKGLRLHDNPALSHIFTAANAAPGKYFVRPIFILDPGILDWMQVGANRWRFLQQTLED----- 70
            |||:.|||||||||  |....:..|    |.|:|:               |...::|.::     
 Frog   235 WFRRDLRLHDNPAL--ISALEHGVP----VIPVFL---------------WCINEETGQNFTLAT 278

  Fly    71 -------LDNQLRKLNSRLFVVRGKPAEVFPRIFKSWRVEM--LTFETD---------IEPYSVT 117
                   |.:.|.|||..|....|  :.:..|:.:|...|:  |..||.         .||:...
 Frog   279 GGATKYWLHHALLKLNQSLIQRFG--SHIIFRVARSCEEELVSLVHETGADTIIINAVYEPWLKE 341

  Fly   118 RDAAVQKLAKAEGVRVETHCSHTIYNPELVIAKNLGKAPI-TYQKFLGIVEQ---------LKVP 172
            ||..:.:..:..||.::.|.|:.:|.|:.|..:.:|...| :...|:...::         |..|
 Frog   342 RDDLISETLRRHGVELKKHHSYCLYEPDSVSTEGVGLRGIGSVSHFMSCCKRNNSAPIGMPLDAP 406

  Fly   173 KVLGVP-----------EKLKNMPTPPKDEVEQKDSAAYD-CPTMKQLVKRPEELGPNKFPGGET 225
            :.|..|           .:|..||       .:||....| ..|:::           .:...|.
 Frog   407 RCLPAPCNWPESDHLDTLELGKMP-------HRKDGTLIDWAVTIRE-----------SWDFSED 453

  Fly   226 EALRRMEESLKDEIWVARFEKPNTAPNSLEPSTTVLSPYLKFGCLSARLFNQKLKEIIKRQPKHS 290
            .|...:...|:|  .|..:||.:...:  :|.|:.:||||.||.:|.|....:.....|..||  
 Frog   454 GAYTCLANFLQD--GVKHYEKESGRAD--KPYTSHISPYLHFGQISPRTVLHEAYFTKKNVPK-- 512

  Fly   291 QPPVSLIGQLMWREFYYTVAAAEPNF-DRMLGNVYCMQIPWQEHPDHLEAWTHGRTGYPFIDAIM 354
                 .:.:|.||:..|.:....|:. ...:...|..| .|....:||.||..|.||||.:||.|
 Frog   513 -----FLRKLAWRDLAYWLLILFPDMPSEPVRPAYKSQ-RWSSDLNHLRAWQKGLTGYPLVDAAM 571

  Fly   355 RQLRQEGWIHHLARHAVACFLTRGDLWISWEEGQRVFEQLLLDQDWALNAGNWMWLSASAFFHQY 419
            |:|...||:.:.:||.||.||. ..|.|.|..|.|.|:..|||.|.|:||..|.....|...|..
 Frog   572 RELWLTGWMCNYSRHVVASFLV-AYLHIHWVHGYRWFQDTLLDADVAINAMMWQNGGMSGLDHWN 635

  Fly   420 FRVYSPVAFGKKTDPQGHYIRKYVPELSKYPAGCIYEPWKASLVDQRAYGCVLGTDYPHRIVKH- 483
            | |..||......||.|.|:||:.|||:..|...|::|||.:....|..|.:||.:||||||.. 
 Frog   636 F-VMHPVDSALTCDPYGSYVRKWCPELAGLPDEYIHKPWKCAPSQLRRAGVILGRNYPHRIVLDL 699

  Fly   484 EVVHKENIKRMGAAYKVNREVRTGKEEESSFEEKSETS---------------TSGKRK-VRRAT 532
            |...::::|.:         |...|:.....:|.|...               |||:.: ||..|
 Frog   700 EERREQSLKDV---------VEVRKKHLEYLDEVSGCDMVQIPDQLLALTLGHTSGEDEVVRNRT 755

  Fly   533 GS 534
            ||
 Frog   756 GS 757

Known Domains:


GeneSequenceDomainRegion External IDIdentity
phr6-4NP_001260632.1 PhrB 5..499 CDD:223492 153/535 (29%)
DNA_photolyase 9..162 CDD:279247 45/175 (26%)
FAD_binding_7 223..496 CDD:281440 96/275 (35%)
LOC100486741XP_002938187.1 PhrB 229..708 CDD:223492 152/528 (29%)
DNA_photolyase 232..373 CDD:279247 43/161 (27%)
FAD_binding_7 452..708 CDD:281440 95/270 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D378952at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.