DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: phr6-4 and cry2

Sequence 1:NP_001260632.1 Gene:phr6-4 FlyBaseID:FBgn0016054 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_002934138.2 Gene:cry2 XenbaseID:XB-GENE-984563 Length:662 Species:Xenopus tropicalis

Alignment Length:489 Identity:240/490 (49%)
Similarity:318/490 (65%) Gaps:11/490 (2%)


  Fly    62 RFLQQTLEDLDNQLRKLNSRLFVVRGKPAEVFPRIFKSWRVEMLTFETDIEPYSVTRDAAVQKLA 126
            |||.|:|||||..|||||||||||||:||:||||:||.|.|..||||.|.||:...|||.:.|||
 Frog   149 RFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVSRLTFEYDSEPFGKERDAVIMKLA 213

  Fly   127 KAEGVRVETHCSHTIYNPELVIAKNLGKAPITYQKFLGIVEQLKVPKVLGVPEKLKNMPTPPKDE 191
            |..||.|....|||:|:.:.:|..|....|:||::|..|:.::::|: ...|...:......:.|
 Frog   214 KEAGVEVIVENSHTLYDLDRIIELNGHSPPLTYKRFQAIISRMELPR-RPAPSVTRQQMEACRAE 277

  Fly   192 VEQKDSAAYDCPTMKQLVKRPEELGPNKFPGGETEALRRMEESLKDEIWVARFEKPNTAPNSLEP 256
            :::.....|..|::.:|....|..||:.:||||||||.|::..|:.:.|||.:|:|....|||..
 Frog   278 IKRNHDETYGVPSLDELGFHSEIKGPSIWPGGETEALARLDRHLERKAWVANYERPRMNANSLLA 342

  Fly   257 STTVLSPYLKFGCLSARLFNQKLKEIIKRQPKHSQPPVSLIGQLMWREFYYTVAAAEPNFDRMLG 321
            |.|.|||||:|||||.|||..:|||:.|:..|:|.||:||.|||:||||:||.|...|.||:|.|
 Frog   343 SPTGLSPYLRFGCLSCRLFYYRLKELYKKVKKNSPPPLSLYGQLLWREFFYTAATNNPKFDQMEG 407

  Fly   322 NVYCMQIPWQEHPDHLEAWTHGRTGYPFIDAIMRQLRQEGWIHHLARHAVACFLTRGDLWISWEE 386
            |..|:||||.::|..|..|..|:||:|:|||||.||||||||||||||||||||||||||.|||.
 Frog   408 NPICVQIPWDKNPKALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWNSWEC 472

  Fly   387 GQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPVAFGKKTDPQGHYIRKYVPELSKYPA 451
            |.:||::||||.|:::|||:|||||.||||.|:|..|.||.||::|||.|.|:|:|:|.|..:|:
 Frog   473 GVKVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYVRRYLPVLKAFPS 537

  Fly   452 GCIYEPWKASLVDQRAYGCVLGTDYPHRIVKHEVVHKENIKRMGAAYK---------VNREVRTG 507
            ..|||||.|....|:...|::|.|||..||.|....:.||:||...|:         :...|.:.
 Frog   538 RYIYEPWSAPESVQKEAKCIIGIDYPKPIVNHAEASRMNIERMKQTYQQLSRYRGLCILASVPSC 602

  Fly   508 KEE-ESSFEEKSETSTSGKRKVRRATGSAPKRKR 540
            .|: .....:.|:..:....|.......:|||||
 Frog   603 MEDLGGPMADSSQNISEAAPKQSLCNVESPKRKR 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
phr6-4NP_001260632.1 PhrB 5..499 CDD:223492 231/437 (53%)
DNA_photolyase 9..162 CDD:279247 58/100 (58%)
FAD_binding_7 223..496 CDD:281440 159/273 (58%)
cry2XP_002934138.2 photolyase_8HDF 138..587 CDD:274644 231/439 (53%)
DNA_photolyase <149..265 CDD:279247 62/117 (53%)
FAD_binding_7 309..582 CDD:281440 159/273 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0415
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D378952at2759
OrthoFinder 1 1.000 FOG0000616
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.