DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arpc2 and scrn2

Sequence 1:NP_001286102.1 Gene:Arpc2 FlyBaseID:FBgn0032859 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001072449.1 Gene:scrn2 XenbaseID:XB-GENE-1005950 Length:446 Species:Xenopus tropicalis

Alignment Length:62 Identity:16/63 (25%)
Similarity:30/63 (48%) Gaps:11/63 (17%)


  Fly    56 RISISL---KFYKQLQEHGADELLKREYGSLLTDTEEGYNVSVLINLEEIPEDCEQIAKRIG 114
            ::|||:   :.:.||:.|.    |::.:    .|.:..:|.|.:.:||:.|...|....|.|
 Frog   202 QLSISVCPWREHPQLRSHA----LQQGW----WDGQGDFNFSAVYSLEKQPVRMEAAKLRYG 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arpc2NP_001286102.1 P34-Arc 57..284 CDD:281970 16/62 (26%)
scrn2NP_001072449.1 Ntn_hydrolase 20..398 CDD:320988 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.