DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arpc2 and Arpc2

Sequence 1:NP_001286102.1 Gene:Arpc2 FlyBaseID:FBgn0032859 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001344316.1 Gene:Arpc2 MGIID:1923959 Length:300 Species:Mus musculus

Alignment Length:297 Identity:225/298 (76%)
Similarity:260/298 (87%) Gaps:0/298 (0%)


  Fly     1 MILLEINNRIIEETLLVKYRNAQAGLKPESIDIRIADFDGVLYHISNVNGDKTKVRISISLKFYK 65
            |||||:|||||||||.:|:.||.||.|||::::..||||||||||||.|||||||.:||||||||
Mouse     1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYK 65

  Fly    66 QLQEHGADELLKREYGSLLTDTEEGYNVSVLINLEEIPEDCEQIAKRIGLLKRNCFASVFEKYFD 130
            :||.|||||||||.|||.|.:.|.|||||:|.:||.:|...:.|..:.|:||||||||||||||.
Mouse    66 ELQAHGADELLKRVYGSFLVNPEPGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQ 130

  Fly   131 YQEQGEEGQKRAVINYRNDETLYVEAKPDRVTVVFSTIFRDEDDVIIGKVFMQELREGRRASHTA 195
            :||:|:||:.||||:||:|||:|||:|.|||||||||:|:|:|||:||||||||.:|||||||||
Mouse   131 FQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTA 195

  Fly   196 PQVLFSHREPPLELANTDARVGDNIGYVTFVLFPRHTNKETRDNTINLIHMFRDYLHYHIKCSKA 260
            ||||||||||||||.:|||.|||||||:||||||||||...|||||||||.||||||||||||||
Mouse   196 PQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNATARDNTINLIHTFRDYLHYHIKCSKA 260

  Fly   261 YIHSRMRAKTSDFLKVLNRARPEPKNTEKKTITGRTF 297
            |||:||||||||||||||||||:.:..|.|||||:||
Mouse   261 YIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTF 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arpc2NP_001286102.1 P34-Arc 57..284 CDD:281970 176/227 (78%)
Arpc2NP_001344316.1 P34-Arc 57..284 CDD:309249 176/227 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C248843460
eggNOG 1 0.900 E1_COG4690
Hieranoid 1 1.000
Homologene 1 1.000 H4187
Inparanoid 1 1.050 472 1.000 Inparanoid score I1490
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004271
OrthoInspector 1 1.000 T1084306
orthoMCL 1 0.900 OOG5_128966
Panther 1 1.100 LDO PTHR12058
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R88
TreeFam 1 0.960
1211.880

Return to query results.
Submit another query.