DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and si:ch211-212o1.2

DIOPT Version :8

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_005159144.1 Gene:si:ch211-212o1.2 / 492735 ZFINID:ZDB-GENE-041111-310 Length:288 Species:Danio rerio

Alignment Length:310 Identity:168/311 (54%)
Similarity:210/311 (68%) Gaps:31/311 (10%)


  Fly     1 MAAK--SDMDILANSMYEDDPNGNLAPATTKDKESVKPEELKVTPAGTKATSPPNSATLVSTSPR 63
            |||.  |:.:|...||.|:|||||                             .:.|...||:||
Zfish     6 MAAALLSETEIRHRSMAEEDPNGN-----------------------------EHGAAARSTAPR 41

  Fly    64 WGPQNKGAQELALLYSPGKRAQEIICVYTCIGLMIINLALIVRHLRLERISVAFLSALCGIITAD 128
            ||||:.||::||.|||||||.||.|||..|:.|.|:||:.:..:.....|.......:.||:|||
Zfish    42 WGPQHAGARQLAKLYSPGKRLQEWICVILCLSLFIVNLSFLFLNFSTVHIYRIIFGIVTGIVTAD 106

  Fly   129 FASGLVHWAADTWGSVDIPMIGKNFLRPFREHHLDPTSITRHDFIETNGDNFMVGIPILGYLAHY 193
            ||||:|||.||||||||||:|||.|:|||||||:|||:|||||||||||||.|:.|..|.::|:.
Zfish   107 FASGMVHWGADTWGSVDIPVIGKAFIRPFREHHIDPTAITRHDFIETNGDNCMITILPLAHMAYK 171

  Fly   194 FYIRTPSEIQQHFGWIAYVFLCSIFVAMTNQIHKWSHTYWGLPRWVLLLQSCHIILPRKHHRIHH 258
            |....|..:.:.:.|..:||..::||.||||||||:|:|:.|||||.|||.||::||||||||||
Zfish   172 FLSYPPDALAESYPWECFVFALAVFVTMTNQIHKWAHSYFDLPRWVTLLQDCHLVLPRKHHRIHH 236

  Fly   259 VAPHETYFCITTGWLNWPLERIRFWSTFELIIEHFTGLKPRDDDLKWAKK 308
            |:|||||:||||||||:||:|:.||.|.|.:||..||.:||.|||.||||
Zfish   237 VSPHETYYCITTGWLNYPLDRVGFWRTMEWLIERLTGQRPRSDDLAWAKK 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 116/177 (66%)
si:ch211-212o1.2XP_005159144.1 TMEM189_B_dmain 102..279 CDD:287490 116/177 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C199652938
eggNOG 1 0.900 E1_KOG3011
Hieranoid 1 1.000
Homologene 1 1.000 H129577
Inparanoid 1 1.050 357 1.000 Inparanoid score I2158
OMA 1 1.010
OrthoDB 1 1.010 D1421561at2759
OrthoFinder 1 1.000 FOG0004732
OrthoInspector 1 1.000 T597170
orthoMCL 1 0.900 OOG5_130997
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4428
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.700

Return to query results.
Submit another query.