DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and Ubc7

DIOPT Version :8

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster

Alignment Length:80 Identity:19/81 (23%)
Similarity:31/81 (38%) Gaps:16/81 (20%)


  Fly    17 DDPNGNLAPATTKDKESVKPEELKVTPAGTKATSPPNSATLV--STSPRWGPQNK---------- 69
            |.|.|.:|...::| ...:.|.|...|.||........|.|:  :..|...|:.|          
  Fly    19 DPPEGIVAGPISED-NFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSPPKMKFTCDMFHPNI 82

  Fly    70 ---GAQELALLYSPG 81
               |...:::|::||
  Fly    83 FADGRVCISILHAPG 97

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 19/81 (23%)
UQ_con 8..159 CDD:278603 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124454514
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.