DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and CG14739

DIOPT Version :8

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster

Alignment Length:241 Identity:44/242 (18%)
Similarity:78/242 (32%) Gaps:87/242 (36%)


  Fly    97 MIINLALIVRHLRLERISVAFLSA--------------LC--GIITADFASGLVHWAADTWGSVD 145
            :::|..|.:...||:|.....|::              :|  |.:.:.:..|:  |..:.....|
  Fly     5 LLVNTTLPMAGRRLDRDVNRLLASGYRTTVDDDMTNLNVCLEGPLGSAYEGGI--WTVNVTMPQD 67

  Fly   146 IPMIGKNFLRPFREHHLDPTSITR--HDFIETNGDNFMVGIPILGYLAHYFYIRTPSEIQQHFGW 208
            .|:.....           ..:|:  |..||     |:.|:..:..|..              .|
  Fly    68 YPLTAPRV-----------RFVTKILHPNIE-----FITGLVCMNVLKQ--------------AW 102

  Fly   209 IAYVFLCSIFVAMTNQIHKWSHTYWGLPRWVLLLQSCHIILPRKHHRIHHVAPH-ETYF------ 266
            .:...|.:||.....|:.::.:.:..|                 :||...:..| |..|      
  Fly   103 SSSYDLVNIFETFLPQLLRYPNPHDSL-----------------NHRAAAIMKHSEQLFREHVIL 150

  Fly   267 CITTGWL--NWPLERIRFWSTFELIIEHFTGLKPRDDDLKWAKKLT 310
            |:.|..:  |.|        |.:|:.|   ||:.|..||..:..||
  Fly   151 CMKTYAMPANLP--------TRQLVEE---GLEKRSSDLSLSDLLT 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 32/188 (17%)
CG14739NP_650151.1 UQ_con 17..152 CDD:278603 29/184 (16%)
COG5078 12..157 CDD:227410 30/194 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124455240
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.