DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and TMEM189-UBE2V1

DIOPT Version :8

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_954673.1 Gene:TMEM189-UBE2V1 / 387522 HGNCID:33521 Length:370 Species:Homo sapiens

Alignment Length:245 Identity:133/246 (54%)
Similarity:165/246 (67%) Gaps:11/246 (4%)


  Fly    63 RWGPQNKGAQELALLYSPGKRAQEIICVYTCIGLMIINLALIVRHLRLERISVAFLSALCGIITA 127
            |||.|:.||:|||.|||||||.||...|..|..|:..||..::...|.|...:..|..:.|.:.|
Human    23 RWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIA 87

  Fly   128 DFASGLVHWAADTWGSVDIPMIGKNFLRPFREHHLDPTSITRHDFIETNGDNFMVG-IPILGYLA 191
            ||.||||||.|||||||::|::||.|:|||||||:|||:|||||||||||||.:|. :|:|. :|
Human    88 DFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLN-MA 151

  Fly   192 HYFYIRTPSEIQQHFGWIAYVFLCSIFVAMTNQIHKWSHTYWGLPRWVLLLQSCHIILPRKHHRI 256
            :.|...:|..::|.:.|..:||...||...|||||||||||:||||||.|||..|:|||||||||
Human   152 YKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRI 216

  Fly   257 HHVAPHETYFCITTGWLNWPLERIRFWSTFELIIEHFTGLK-PRDDDLKW 305
            |||:|||||||||||        ::....|.|:.|...|.| ..|..:.|
Human   217 HHVSPHETYFCITTG--------VKVPRNFRLLEELEEGQKGVGDGTVSW 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 105/179 (59%)
TMEM189-UBE2V1NP_954673.1 TMEM189_B_dmain 85..251 CDD:287490 104/175 (59%)
UBCc 239..365 CDD:214562 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3011
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 321 1.000 Inparanoid score I2483
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1421561at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T609535
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4428
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.