powered by:
Protein Alignment Kua and CG16894
DIOPT Version :9
| Sequence 1: | NP_001188856.1 |
Gene: | Kua / 35300 |
FlyBaseID: | FBgn0032850 |
Length: | 310 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_611455.1 |
Gene: | CG16894 / 37280 |
FlyBaseID: | FBgn0034483 |
Length: | 266 |
Species: | Drosophila melanogaster |
| Alignment Length: | 37 |
Identity: | 9/37 - (24%) |
| Similarity: | 10/37 - (27%) |
Gaps: | 19/37 - (51%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 126 TADFASGLVHWAADTWGSVDIPMIGKNFLRPFREHHL 162
|.|.|..|..|..| |||:
Fly 98 TLDLAHFLNEWRKD-------------------EHHI 115
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45438135 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.