DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and CG16894

DIOPT Version :9

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:37 Identity:9/37 - (24%)
Similarity:10/37 - (27%) Gaps:19/37 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 TADFASGLVHWAADTWGSVDIPMIGKNFLRPFREHHL 162
            |.|.|..|..|..|                   |||:
  Fly    98 TLDLAHFLNEWRKD-------------------EHHI 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 9/37 (24%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 9/37 (24%)
UBCc 23..173 CDD:294101 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.