powered by:
Protein Alignment Kua and CG16894
DIOPT Version :9
Sequence 1: | NP_001188856.1 |
Gene: | Kua / 35300 |
FlyBaseID: | FBgn0032850 |
Length: | 310 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611455.1 |
Gene: | CG16894 / 37280 |
FlyBaseID: | FBgn0034483 |
Length: | 266 |
Species: | Drosophila melanogaster |
Alignment Length: | 37 |
Identity: | 9/37 - (24%) |
Similarity: | 10/37 - (27%) |
Gaps: | 19/37 - (51%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 TADFASGLVHWAADTWGSVDIPMIGKNFLRPFREHHL 162
|.|.|..|..|..| |||:
Fly 98 TLDLAHFLNEWRKD-------------------EHHI 115
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45438135 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.