DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and Tmem189

DIOPT Version :8

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001107224.1 Gene:Tmem189 / 362278 RGDID:1309093 Length:271 Species:Rattus norvegicus

Alignment Length:248 Identity:147/248 - (59%)
Similarity:180/248 - (72%) Gaps:2/248 - (0%)


  Fly    63 RWGPQNKGAQELALLYSPGKRAQEIICVYTCIGLMIINLALIVRHLRLERISVAFLSALCGIITA 127
            |||.|:.||:|||.|||||||.||...|..|..|:..|...::...|.|...:..|..:.|.:.|
  Rat    24 RWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNSVHLLLLARWEHTPLVILGVVAGALVA 88

  Fly   128 DFASGLVHWAADTWGSVDIPMIGKNFLRPFREHHLDPTSITRHDFIETNGDNFMVG-IPILGYLA 191
            ||.||||||.||||||||:|::||.|:|||||||:|||:|||||||||||||.:|. :|:|. :|
  Rat    89 DFLSGLVHWGADTWGSVDLPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLN-MA 152

  Fly   192 HYFYIRTPSEIQQHFGWIAYVFLCSIFVAMTNQIHKWSHTYWGLPRWVLLLQSCHIILPRKHHRI 256
            :.|..::|..::|.:.|..:||...||...|||||||||||.|||.||.:||..|:|||||||||
  Rat   153 YKFQTQSPETLEQLYPWECFVFCLIIFGTFTNQIHKWSHTYLGLPCWVTVLQDWHVILPRKHHRI 217

  Fly   257 HHVAPHETYFCITTGWLNWPLERIRFWSTFELIIEHFTGLKPRDDDLKWAKKL 309
            ||||||||||||||||||:|||.|.||...|.:|:..||.|||.||:|||:|:
  Rat   218 HHVAPHETYFCITTGWLNYPLEVIGFWRRLEDVIQSLTGEKPRADDMKWAQKI 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 115/177 (65%)
Tmem189NP_001107224.1 TMEM189_B_dmain 86..262 CDD:287490 115/176 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1421561at2759
OrthoFinder 1 1.000 FOG0004732
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.